RanBP3 Antibody (2E10.)

Images

 
Western Blot: RanBP3 Antibody (2E10) [H00008498-M01] - Analysis of RANBP3 expression in transfected 293T cell line by RANBP3 monoclonal antibody (M01), clone 2E10.Lane 1: RANBP3 transfected lysate(42.4 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: RanBP3 Antibody (2E10) [H00008498-M01] - Analysis of monoclonal antibody to RANBP3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: RanBP3 Antibody (2E10) [H00008498-M01] - Detection limit for recombinant GST tagged RANBP3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RanBP3 Antibody (2E10.) Summary

Immunogen
RANBP3 (AAH04349, 298 a.a. - 397 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWLLRHPHPSHPAVGPCLCGEQPALCPCPGLPNYRPGTPAQLGGLLVRV
Specificity
RANBP3 - RAN binding protein 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RANBP3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been use for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RanBP3 Antibody (2E10.)

  • DKFZp586I1520
  • RAN binding protein 3
  • ran-binding protein 3
  • RAN-binding protein-3
  • RanBP3

Background

This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-32751
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
H00008498-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RanBP3 Antibody (H00008498-M01) (0)

There are no publications for RanBP3 Antibody (H00008498-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RanBP3 Antibody (H00008498-M01) (0)

There are no reviews for RanBP3 Antibody (H00008498-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RanBP3 Antibody (H00008498-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RanBP3 Products

Bioinformatics Tool for RanBP3 Antibody (H00008498-M01)

Discover related pathways, diseases and genes to RanBP3 Antibody (H00008498-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RanBP3 Antibody (H00008498-M01)

Discover more about diseases related to RanBP3 Antibody (H00008498-M01).
 

Pathways for RanBP3 Antibody (H00008498-M01)

View related products by pathway.

PTMs for RanBP3 Antibody (H00008498-M01)

Learn more about PTMs related to RanBP3 Antibody (H00008498-M01).
 

Research Areas for RanBP3 Antibody (H00008498-M01)

Find related products by research area.

Blogs on RanBP3

There are no specific blogs for RanBP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RanBP3 Antibody (2E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RANBP3
Entrez
OMIM
Uniprot