RAG1 Antibody

Western Blot: RAG1 Antibody [NBP1-74190] - Mouse Liver Lysate 1ug/ml Gel Concentration 6-18%

• Reactivity: Mu
• Applications: WB, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RAG1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against Rag1 and was validated on Western blot.Chromatin Immunoprecipitation was reported in scientific literature.
• Theoretical MW: 119 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAG1 Antibody

• MGC43321
• RAG-1
• recombination activating gene 1
• RING finger protein 74
• RNF74recombination activating protein 1
• V(D)J recombination-activating protein 1

Background

As a catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAG1 Antibody (NBP1-74190)(2)

Publications using NBP1-74190

• Lu Y, Wu Y, Feng X et al. CDK4 deficiency promotes genomic instability and enhances Myc-driven lymphomagenesis. J. Clin. Invest. 2014-03-10 [PMID: 24614102] (WB, Mouse)
• Zhou XF, Yu J, Chang M et al. TRIM28 mediates chromatin modifications at the TCRalpha enhancer and regulates the development of T and natural killer T cells Proc Natl Acad Sci U S A 2012-12-04 [PMID: 23169648] (Chemotaxis, Mouse)

Bioinformatics

• Gene Symbol: RAG1
• Uniprot:
  • P15919(Mouse)