RAG1 Antibody

Images

 
Western Blot: RAG1 Antibody [NBP1-74190] - Mouse Liver Lysate 1ug/ml Gel Concentration 6-18%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAG1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Chromatin Immunoprecipitation
Application Notes
This is a rabbit polyclonal antibody against Rag1 and was validated on Western blot.Chromatin Immunoprecipitation was reported in scientific literature.
Theoretical MW
119 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-74190 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAG1 Antibody

  • MGC43321
  • RAG-1
  • recombination activating gene 1
  • RING finger protein 74
  • RNF74recombination activating protein 1
  • V(D)J recombination-activating protein 1

Background

As a catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41159
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-34098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready

Publications for RAG1 Antibody (NBP1-74190)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ChIP, WB.


Filter By Application
ChIP
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(2)
All Species

Reviews for RAG1 Antibody (NBP1-74190) (0)

There are no reviews for RAG1 Antibody (NBP1-74190). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Webinar
ChIP Video Protocol

FAQs for RAG1 Antibody (NBP1-74190) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAG1 Products

Bioinformatics Tool for RAG1 Antibody (NBP1-74190)

Discover related pathways, diseases and genes to RAG1 Antibody (NBP1-74190). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAG1 Antibody (NBP1-74190)

Discover more about diseases related to RAG1 Antibody (NBP1-74190).
 

Pathways for RAG1 Antibody (NBP1-74190)

View related products by pathway.

PTMs for RAG1 Antibody (NBP1-74190)

Learn more about PTMs related to RAG1 Antibody (NBP1-74190).

Blogs on RAG1

There are no specific blogs for RAG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAG1
Uniprot