RAC3 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
RAC3 (NP_005043.1, 1 a.a. - 192 a.a.) full-length human protein. MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF |
| Specificity |
Reacts with ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3). |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RAC3 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RAC3 Antibody - Azide and BSA Free
Background
The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, PLA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Publications for RAC3 Antibody (H00005881-D01P) (0)
There are no publications for RAC3 Antibody (H00005881-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RAC3 Antibody (H00005881-D01P) (0)
There are no reviews for RAC3 Antibody (H00005881-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RAC3 Antibody (H00005881-D01P). (Showing 1 - 1 of 1 FAQ).
-
I have a customer who is interested this RAC3 antibody (Cat#H00005881-D01P) for Western blotting. They were asking how specific this antibody is for RAC3 (versus other RAC proteins - with which RAC3 shares a high level of sequence similarity)? Does this antibody cross-react with RAC 1 and 2? Are there any western blot images of non-transfected, whole cell lysates? (the example image on website has transfected cell line expression on Western blot).
- This antibody is produced by a Taiwanese company called Abnova and we distribute for them. We do no in-house testing or development on their products. The only images available are the ones that Abnova has generated. This is a polyclonal antibody and the immunogen is full-length RAC3. RAC3 shares 94% and 89% similarity with RAC1 and RAC2, respectively. Chances of cross-reactivity with other RAC proteins is quite high. This is true for probably any polyclonal antibody commercially produced against RAC3. A monoclonal is probably the best bet for this target.
Secondary Antibodies
| |
Isotype Controls
|
Additional RAC3 Products
Research Areas for RAC3 Antibody (H00005881-D01P)
Find related products by research area.
|
Blogs on RAC3