Rab5b Antibody

Images

 
Western Blot: Rab5b Antibody [NBP1-58938] - Human placenta tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: Rab5b Antibody [NBP1-58938] - Sample type: zebra gut epithelial cells, Green: primary, Red: actin, Blue : DAPI, Primary dilution : 1:5000, Secondary Dilution : 1:300, Image Submitted by: ...read more

Product Details

Summary
Reactivity Hu, MaSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

Rab5b Antibody Summary

Immunogen
Synthetic peptides corresponding to RAB5B(RAB5B, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB5B. Peptide sequence MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE.
Marker
Early Endosome Marker
Clonality
Polyclonal
Host
Rabbit
Gene
RAB5B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against RAB5B and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rab5b Antibody

  • RAB5B, member RAS oncogene family
  • ras-related protein Rab-5B

Background

RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-80858
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-129
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-22217
Species: Hu, Mu(-), Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB9521
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-49118
Species: Hu
Applications: IHC
MAB8967
Species: Hu
Applications: WB, Simple Western, ICC

Publications for Rab5b Antibody (NBP1-58938) (0)

There are no publications for Rab5b Antibody (NBP1-58938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab5b Antibody (NBP1-58938) (0)

There are no reviews for Rab5b Antibody (NBP1-58938). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab5b Antibody (NBP1-58938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rab5b Antibody Products

Rab5b NBP1-58938

Related Products by Gene

Bioinformatics Tool for Rab5b Antibody (NBP1-58938)

Discover related pathways, diseases and genes to Rab5b Antibody (NBP1-58938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab5b Antibody (NBP1-58938)

Discover more about diseases related to Rab5b Antibody (NBP1-58938).
 

Pathways for Rab5b Antibody (NBP1-58938)

View related products by pathway.

PTMs for Rab5b Antibody (NBP1-58938)

Learn more about PTMs related to Rab5b Antibody (NBP1-58938).
 

Research Areas for Rab5b Antibody (NBP1-58938)

Find related products by research area.

Blogs on Rab5b

There are no specific blogs for Rab5b, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RAB5B
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-58938 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought