![Western Blot: Rab5b Antibody [NBP1-58938] - Human placenta tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/fullsize/Rab5b-Antibody-Western-Blot-NBP1-58938-img0001.jpg "Western Blot: Rab5b Antibody [NBP1-58938] - Human placenta tissue lysate at a concentration of 1ug/ml.")
| Reactivity | Hu, Mu, Ma, ZeSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to RAB5B(RAB5B, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB5B. Peptide sequence MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE. The peptide sequence for this immunogen was taken from within the described region. |
| Marker | Early Endosome Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB5B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Rab5b Antibody (NBP1-58938)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Rab5b Antibody [NBP1-58938] - Sample type: zebra gut epithelial cells, Green: primary, Red: actin, Blue : DAPI, Primary dilution : 1:5000 , Secondary Dilution : 1:300, Image Submitted by: Michel Bagnat, Duke University Medical Center See Customer Feedback tab for detailed information.](http://images.novusbio.com/fullsize/Rab5b-Antibody-Immunohistochemistry-Paraffin-NBP1-58938-img0003.jpg "Immunohistochemistry-Paraffin: Rab5b Antibody [NBP1-58938] - Sample type: zebra gut epithelial cells, Green: primary, Red: actin, Blue : DAPI, Primary dilution : 1:5000 , Secondary Dilution : 1:300, Image Submitted by: Michel Bagnat, Duke University Medical Center See Customer Feedback tab for detailed information.")
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot Glutathione Peroxidase 1/GPX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Glutathione_Peroxidase_1_AF3798_Western_Blot_5348.jpg)
![Simple Western Glutathione Peroxidase 1/GPX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Glutathione_Peroxidase_1_AF3798_Simple_Western_17131.jpg)
![Immunohistochemistry Glutathione Peroxidase 1/GPX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Glutathione_Peroxidase_1_AF3798_Immunohistochemistry_6806.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Western_Blot_20998.jpg)
![Immunohistochemistry Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Immunohistochemistry_17794.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images/af952_human-cathepsin-l-affinity-purified-polyclonal-ab-8220249511428.jpg)
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")