Rab5b Antibody (NBP1-58938)


Western Blot: Rab5b Antibody [NBP1-58938] - Human placenta tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: Rab5b Antibody [NBP1-58938] - Sample type: zebra gut epithelial cells, Green: primary, Red: actin, Blue : DAPI, Primary dilution : 1:5000, Secondary Dilution : 1:300, Image Submitted by: ...read more

Product Details

Reactivity Hu, MaSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Rab5b Antibody Summary

Synthetic peptides corresponding to RAB5B(RAB5B, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB5B. Peptide sequence MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE.
Early Endosome Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against RAB5B and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rab5b Antibody

  • RAB5B, member RAS oncogene family
  • ras-related protein Rab-5B


RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow

Publications for Rab5b Antibody (NBP1-58938) (0)

There are no publications for Rab5b Antibody (NBP1-58938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab5b Antibody (NBP1-58938) (0)

There are no reviews for Rab5b Antibody (NBP1-58938). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab5b Antibody (NBP1-58938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Rab5b Products

Rab5b NBP1-58938

Related Products by Gene

Bioinformatics Tool for Rab5b Antibody (NBP1-58938)

Discover related pathways, diseases and genes to Rab5b Antibody (NBP1-58938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab5b Antibody (NBP1-58938)

Discover more about diseases related to Rab5b Antibody (NBP1-58938).

Pathways for Rab5b Antibody (NBP1-58938)

View related products by pathway.

PTMs for Rab5b Antibody (NBP1-58938)

Learn more about PTMs related to Rab5b Antibody (NBP1-58938).

Research Areas for Rab5b Antibody (NBP1-58938)

Find related products by research area.

Blogs on Rab5b

There are no specific blogs for Rab5b, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Rab5b Antibody and receive a gift card or discount.


Gene Symbol RAB5B

Customers Who Bought This Also Bought