Rab4 Antibody

Images

 
Western Blot: Rab4 Antibody [H00005867-B01P] - Analysis of RAB4A expression in rat brain.
Western Blot: Rab4 Antibody [H00005867-B01P] - Analysis of RAB4A expression in transfected 293T cell line by RAB4A polyclonal antibody. Lane 1: RAB4A transfected lysate(23.98 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rab4 Antibody Summary

Immunogen
RAB4A (NP_004569.2, 1 a.a. - 218 a.a.) full-length human protein. MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
Marker
Early and Recycling Endosomes Marker
Specificity
RAB4A - RAB4A, member RAS oncogene family,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RAB4A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rab4 Antibody

  • Oncogene RAB4
  • RAB4, member RAS oncogene family
  • RAB4A, member RAS oncogene family
  • RAB4HRES-1/RAB4
  • ras-related protein Rab-4A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83606
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00004218-M02
Species: Hu
Applications: WB, ELISA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-31480
Species: Hu
Applications: WB, IHC, IHC-P
H00005867-B01P
Species: Hu, Rt
Applications: WB

Publications for Rab4 Antibody (H00005867-B01P) (0)

There are no publications for Rab4 Antibody (H00005867-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab4 Antibody (H00005867-B01P) (0)

There are no reviews for Rab4 Antibody (H00005867-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab4 Antibody (H00005867-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rab4 Products

Bioinformatics Tool for Rab4 Antibody (H00005867-B01P)

Discover related pathways, diseases and genes to Rab4 Antibody (H00005867-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab4 Antibody (H00005867-B01P)

Discover more about diseases related to Rab4 Antibody (H00005867-B01P).
 

Pathways for Rab4 Antibody (H00005867-B01P)

View related products by pathway.

PTMs for Rab4 Antibody (H00005867-B01P)

Learn more about PTMs related to Rab4 Antibody (H00005867-B01P).
 

Research Areas for Rab4 Antibody (H00005867-B01P)

Find related products by research area.

Blogs on Rab4

There are no specific blogs for Rab4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rab4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB4A
Entrez
Uniprot