RAB3GAP2 Antibody

Images

 
Western Blot: RAB3GAP2 Antibody [NBP1-84199] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: RAB3GAP2 Antibody [NBP1-84199] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: RAB3GAP2 Antibody [NBP1-84199] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB3GAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB3GAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAB3GAP2 Protein (NBP1-84199PEP)
Publications
Read Publication using
NBP1-84199 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB3GAP2 Antibody

  • DKFZP434D245
  • FLJ14579
  • KIAA0839p150
  • RAB3 GTPase activating protein subunit 2 (non-catalytic)
  • Rab3 GTPase-activating protein 150 kDa subunit
  • rab3 GTPase-activating protein non-catalytic subunit
  • Rab3-GAP p150
  • Rab3-GAP regulatory subunit
  • RAB3GAP150
  • RAB3-GAP150
  • RGAP-iso

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
796-IC
Species: Mu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-43567
Species: Hu, Mu
Applications: WB
NBP1-88854
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84199
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RAB3GAP2 Antibody (NBP1-84199)(1)

We have publications tested in 2 confirmed species: Human, Monkey.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Monkey
(1)
All Species

Reviews for RAB3GAP2 Antibody (NBP1-84199) (0)

There are no reviews for RAB3GAP2 Antibody (NBP1-84199). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB3GAP2 Antibody (NBP1-84199) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB3GAP2 Products

Bioinformatics Tool for RAB3GAP2 Antibody (NBP1-84199)

Discover related pathways, diseases and genes to RAB3GAP2 Antibody (NBP1-84199). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB3GAP2 Antibody (NBP1-84199)

Discover more about diseases related to RAB3GAP2 Antibody (NBP1-84199).
 

Pathways for RAB3GAP2 Antibody (NBP1-84199)

View related products by pathway.

Blogs on RAB3GAP2

There are no specific blogs for RAB3GAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB3GAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB3GAP2