RAB31 Antibody

Images

 
Orthogonal Strategies: Western Blot: RAB31 Antibody [NBP1-80859] - Analysis in human cell lines HeLa and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: RAB31 Antibody [NBP1-80859] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Western Blot: RAB31 Antibody [NBP1-80859] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RAB31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RAB31 Protein (NBP1-80859PEP)
Publications
Read Publication using NBP1-80859.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23319410)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB31 Antibody

  • Rab22B
  • RAB31, member RAS oncogene family
  • Ras-related protein Rab-22B
  • ras-related protein Rab-31

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5320
Species: Hu
Applications: WB
NBP1-56889
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB367
Species: Ca, Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
236-EG
Species: Hu
Applications: BA
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00009322-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00338382-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-42225
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB

Publications for RAB31 Antibody (NBP1-80859)(1)


Reviews for RAB31 Antibody (NBP1-80859) (0)

There are no reviews for RAB31 Antibody (NBP1-80859). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB31 Antibody (NBP1-80859) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB31 Products

Bioinformatics Tool for RAB31 Antibody (NBP1-80859)

Discover related pathways, diseases and genes to RAB31 Antibody (NBP1-80859). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB31 Antibody (NBP1-80859)

Discover more about diseases related to RAB31 Antibody (NBP1-80859).
 

Pathways for RAB31 Antibody (NBP1-80859)

View related products by pathway.

Research Areas for RAB31 Antibody (NBP1-80859)

Find related products by research area.

Blogs on RAB31

There are no specific blogs for RAB31, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB31
Entrez
Uniprot