RAB23 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RAB23 Antibody [NBP1-86366] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & centrosome.
Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366] - Staining of human vulva/anal skin shows strong cytoplasmic and additional nucleolar positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAB23 Protein (NBP1-86366PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB23 Antibody

  • DKFZp781H0695
  • HSPC137
  • MGC8900
  • RAB family small GTP binding protein RAB 23
  • RAB23, member RAS oncogene family
  • ras-related protein Rab-23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB300-621
Species: Hu, Rt, Bv, Ca, Ha, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP
NBP1-85966
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-16657
Species: Hu
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF

Publications for RAB23 Antibody (NBP1-86366) (0)

There are no publications for RAB23 Antibody (NBP1-86366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB23 Antibody (NBP1-86366) (0)

There are no reviews for RAB23 Antibody (NBP1-86366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RAB23 Antibody (NBP1-86366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB23 Products

Bioinformatics Tool for RAB23 Antibody (NBP1-86366)

Discover related pathways, diseases and genes to RAB23 Antibody (NBP1-86366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB23 Antibody (NBP1-86366)

Discover more about diseases related to RAB23 Antibody (NBP1-86366).
 

Pathways for RAB23 Antibody (NBP1-86366)

View related products by pathway.

PTMs for RAB23 Antibody (NBP1-86366)

Learn more about PTMs related to RAB23 Antibody (NBP1-86366).

Blogs on RAB23

There are no specific blogs for RAB23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB23