RAB18 Antibody

Images

 
Western Blot: RAB18 Antibody [NBP1-85966] - Analysis in control (vector only transfected HEK293T lysate) and RAB18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: RAB18 Antibody [NBP1-85966] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSV
Specificity
Specificity of human RAB18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-85966.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB18 Antibody

  • RAB18 small GTPase
  • RAB18, member RAS oncogene family
  • RAB18LI1
  • ras-related protein Rab-18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40877
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP1-55113
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-40764
Species: Hu, Mu, Po, Pm
Applications: WB, ICC/IF
NBP1-87174
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49637
Species: Hu
Applications: IHC, IHC-P
NBP1-31480
Species: Hu
Applications: WB, IHC, IHC-P
NB120-13253
Species: Hu, Mu, Bv, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-30583
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20039
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-85799
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85966
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RAB18 Antibody (NBP1-85966)(1)

Reviews for RAB18 Antibody (NBP1-85966) (0)

There are no reviews for RAB18 Antibody (NBP1-85966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB18 Antibody (NBP1-85966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAB18 Products

Bioinformatics Tool for RAB18 Antibody (NBP1-85966)

Discover related pathways, diseases and genes to RAB18 Antibody (NBP1-85966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB18 Antibody (NBP1-85966)

Discover more about diseases related to RAB18 Antibody (NBP1-85966).
 

Pathways for RAB18 Antibody (NBP1-85966)

View related products by pathway.

PTMs for RAB18 Antibody (NBP1-85966)

Learn more about PTMs related to RAB18 Antibody (NBP1-85966).
 

Research Areas for RAB18 Antibody (NBP1-85966)

Find related products by research area.

Blogs on RAB18

There are no specific blogs for RAB18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB18
Entrez
Uniprot