RAB11FIP5 Antibody


Immunocytochemistry/ Immunofluorescence: RAB11FIP5 Antibody [NBP2-32662] - Immunofluorescent staining of human cell line A-431 shows localization to microtubule organizing center & vesicles.
Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP2-32662] - Staining of human testis shows high expression.
Immunohistochemistry: RAB11FIP5 Antibody [NBP2-32662] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP2-32662] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP2-32662] - Staining in human testis and endometrium tissues using anti-RAB11FIP5 antibody. Corresponding RAB11FIP5 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RAB11FIP5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LCVNGSHIYNEEPQGPVRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAP
Specificity of human RAB11FIP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAB11FIP5 Protein (NBP2-32662PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RAB11FIP5 Antibody

  • DKFZp434H018
  • Gaf-1
  • GAF1rab11-FIP5
  • Gamma-SNAP-associated factor 1
  • KIAA0857gaf-1
  • Phosphoprotein pp75
  • pp75
  • RAB11 family interacting protein 5 (class I)
  • Rab11-FIP5
  • Rab11-interacting protein Rip11
  • RAB11RIP5
  • RIP11rab11 family-interacting protein 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA

Publications for RAB11FIP5 Antibody (NBP2-32662) (0)

There are no publications for RAB11FIP5 Antibody (NBP2-32662).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB11FIP5 Antibody (NBP2-32662) (0)

There are no reviews for RAB11FIP5 Antibody (NBP2-32662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RAB11FIP5 Antibody (NBP2-32662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RAB11FIP5 Antibody (NBP2-32662)

Discover related pathways, diseases and genes to RAB11FIP5 Antibody (NBP2-32662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB11FIP5 Antibody (NBP2-32662)

Discover more about diseases related to RAB11FIP5 Antibody (NBP2-32662).

Pathways for RAB11FIP5 Antibody (NBP2-32662)

View related products by pathway.

PTMs for RAB11FIP5 Antibody (NBP2-32662)

Learn more about PTMs related to RAB11FIP5 Antibody (NBP2-32662).

Blogs on RAB11FIP5

There are no specific blogs for RAB11FIP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAB11FIP5 Antibody and receive a gift card or discount.


Gene Symbol RAB11FIP5