RAB43 Antibody (5G4)

Images

 
Western Blot: RAB43 Antibody (5G4) [H00339122-M01] - RAB43 monoclonal antibody (M01), clone 5G4 Analysis of RAB43 expression in HepG2.
Immunohistochemistry-Paraffin: RAB43 Antibody (5G4) [H00339122-M01] - Analysis of monoclonal antibody to RAB43 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
ELISA: RAB43 Antibody (5G4) [H00339122-M01] - Detection limit for recombinant GST tagged RAB43 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
5G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB43 Antibody (5G4) Summary

Immunogen
RAB43 (NP_940892, 113 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGC
Localization
Cell membrane; Lipid-anchor; Cytoplasmic side
Specificity
RAB43 - RAB43, member RAS oncogene family
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB43
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00339122-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB43 Antibody (5G4)

  • MGC90481
  • RAB11B
  • RAB41ISY1
  • RAB43, member RAS oncogene family
  • Ras-related protein Rab-41
  • ras-related protein Rab-43

Background

Belongs to the small GTPase superfamily. Rab family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51599
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NBP2-20839
Species: Hu
Applications: WB
2914-HT
Species: Hu
Applications: BA
NBP1-81855
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
MAB25031
Species: Hu
Applications: IHC, IP, WB
NBP1-33560
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-45499
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-82949
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00053916-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-93131
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
H00339122-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for RAB43 Antibody (H00339122-M01) (0)

There are no publications for RAB43 Antibody (H00339122-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for RAB43 Antibody (H00339122-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00339122-M01:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
  4
reviewed by:
Haiquan Lu
Western Blot Human 09/08/2015
View

Summary

ApplicationWestern Blot
Sample TestedHuman cancer cell
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB43 Antibody (H00339122-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB43 Products

Bioinformatics Tool for RAB43 Antibody (H00339122-M01)

Discover related pathways, diseases and genes to RAB43 Antibody (H00339122-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB43 Antibody (H00339122-M01)

Discover more about diseases related to RAB43 Antibody (H00339122-M01).
 

Pathways for RAB43 Antibody (H00339122-M01)

View related products by pathway.

Research Areas for RAB43 Antibody (H00339122-M01)

Find related products by research area.

Blogs on RAB43

There are no specific blogs for RAB43, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Haiquan Lu
09/08/2015
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol RAB43
Entrez
Uniprot