![Immunocytochemistry/Immunofluorescence: RAB11FIP2 Antibody [NBP1-82949] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://images.novusbio.com/fullsize2/RAB11FIP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82949-img0005.jpg "Immunocytochemistry/Immunofluorescence: RAB11FIP2 Antibody [NBP1-82949] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB11FIP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 24372966). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/images2/Myosin-VB-Antibody-Immunohistochemistry-Paraffin-NBP1-87746-img0020.jpg)
![Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/images2/Myosin-VB-Antibody-Immunohistochemistry-Paraffin-NBP1-87746-img0021.jpg)
![Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/Myosin-VB-Antibody-Immunohistochemistry-Paraffin-NBP1-87746-img0022.jpg)
![Western Blot: RAB11FIP3 Antibody [NBP2-20034] - Sample (30 ug of whole cell lysate) A: U87-MG 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/RAB11FIP3-Antibody-Western-Blot-NBP2-20034-img0001.jpg)
![Immunohistochemistry-Paraffin: RAB11FIP3 Antibody [NBP2-20034] - Human colon carcinoma, using RAB11FIP3 antibody at 1:500 dilution.Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.](http://images.novusbio.com/images2/RAB11FIP3-Antibody-Immunohistochemistry-Paraffin-NBP2-20034-img0002.jpg)
![ELISA: FIP1/RCP Antibody (1A12B9D8) [NBP2-52546] - Black line: Control Antigen (100 ng); Purple line: Antigen(10ng); Blue line: Antigen (50 ng); Red line: Antigen (100 ng).](http://images.novusbio.com/images2/FIP1-RCP-Antibody-(1A12B9D8)-ELISA-NBP2-52546-img0008.jpg)
![Western Blot: FIP1/RCP Antibody (1A12B9D8) [NBP2-52546] - Analysis using RAB11FIP1 mouse mAb against Raji (1), SW620 (2), A431 (3), SW480 (4), HepG2 (5), Hela (6), and NIH3T3 (7) cell lysate.](http://images.novusbio.com/images2/FIP1-RCP-Antibody-(1A12B9D8)-Western-Blot-NBP2-52546-img0009.jpg)
![Flow Cytometry: FIP1/RCP Antibody (1A12B9D8) [NBP2-52546] - Analysis of Raji cells using RAB11FIP1 mouse mAb (green) and negative control (red).](http://images.novusbio.com/images2/FIP1-RCP-Antibody-(1A12B9D8)-Flow-Cytometry-NBP2-52546-img0001.jpg)
![Western Blot: Opsin 1 (Long Wave) Antibody [NBP3-09392] - Western blot analysis of Opsin 1 (Long Wave) in Fetal Heart lysates. Antibody dilution at 1.0ug/ml](http://images.novusbio.com/images2/Opsin-1-(Long-Wave)-Antibody-Western-Blot-NBP3-09392-img0001.jpg)
![Immunohistochemistry-Paraffin: CRCP Antibody [NBP1-84495] - Staining of human testis shows cytoplasmic and nuclear positivity of cells in seminiferus ducts.](http://images.novusbio.com/images2/CRCP-Antibody-Immunohistochemistry-Paraffin-NBP1-84495-img0005.jpg)
![Western Blot: CRCP Antibody [NBP1-84495] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 10. Lane 2: Human cell line RT-4.](http://images.novusbio.com/images2/CRCP-Antibody-Western-Blot-NBP1-84495-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: CRCP Antibody [NBP1-84495] - Staining of human cell line A-431 shows localization to nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/images2/CRCP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84495-img0006.jpg)
| Publication using NBP1-82949 | Applications | Species |
|---|---|---|
| Schafer JC, Baetz NW, Lapierre LA et al. Rab11-FIP2 Interaction with MYO5B Regulates Movement of Rab11a-Containing Recycling Vesicles. Traffic 2014 Mar [PMID: 24372966] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB11FIP2 |
![Immunohistochemistry-Paraffin: RAB11FIP2 Antibody [NBP1-82949] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/RAB11FIP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82949-img0001.jpg "Immunohistochemistry-Paraffin: RAB11FIP2 Antibody [NBP1-82949] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: Rab11A Antibody [NBP2-49320] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue](http://images.novusbio.com/images2/Rab11A-Antibody-Western-Blot-NBP2-49320-img0003.jpg)
![Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human colon shows moderate positivity in glandular cells.](http://images.novusbio.com/images2/Rab11A-Antibody-Immunohistochemistry-Paraffin-NBP2-49320-img0005.jpg)
![Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/images2/Rab11A-Antibody-Immunohistochemistry-Paraffin-NBP2-49320-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: RAB11FIP5 Antibody [NBP1-81855] - Staining of human cell line A-431 shows localization to microtubule organizing center & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/RAB11FIP5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81855-img0008.jpg)
![Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP1-81855] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/images2/RAB11FIP5-Antibody-Immunohistochemistry-Paraffin-NBP1-81855-img0009.jpg)
![Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP1-81855] - Staining of human testis shows high expression.](http://images.novusbio.com/images2/RAB11FIP5-Antibody-Immunohistochemistry-Paraffin-NBP1-81855-img0010.jpg)
![Western Blot: EHD1 Antibody [NBP2-56035] - Analysis in human cell line A-431 and human cell line HEK 293.](http://images.novusbio.com/images2/EHD1-Antibody-Knockdown-Validated-NBP2-56035-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: EHD1 Antibody [NBP2-56035] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/images2/EHD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56035-img0001.jpg)
![Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/images2/EHD3-Antibody-Immunohistochemistry-Paraffin-NBP2-31896-img0006.jpg)
![Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human liver shows moderate membranous positivity in hepatic sinusoid cells.](http://images.novusbio.com/images2/EHD3-Antibody-Immunohistochemistry-Paraffin-NBP2-31896-img0007.jpg)
![Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human lymphoid tissues shows moderate positivity in reticular fibers in germinal center cells.](http://images.novusbio.com/images2/EHD3-Antibody-Immunohistochemistry-Paraffin-NBP2-31896-img0008.jpg)
![Western Blot: Optineurin Antibody [NBP1-84682] - Analysis in human cell lines A-431 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.](http://images.novusbio.com/images2/Optineurin-Antibody-Western-Blot-NBP1-84682-img0018.jpg)
![Western Blot: Optineurin Antibody [NBP1-84682] - Effect of mitochondrial fission protein, Drp1 (FL) and mutant Tau on Optineurin expression in N2a (M) cells. Lanes: M. Ladder M. Ladder 1. N2a cells 2. N2a cells + mutant Tau 3. N2a cells + mutant tau + Drp1 full length + mutant Tau. This image was submitted via customer review.](http://images.novusbio.com/images2/Optineurin-Antibody-Western-Blot-NBP1-84682-img0022.jpg)
![Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).](http://images.novusbio.com/images2/Optineurin-Antibody-Western-Blot-NBP1-84682-img0023.jpg)
![Flow Cytometry: Rab25 Antibody (3F12) [NBP1-51599] - Analysis of NIH/3T3 cells using Rab25 mouse mAb (green) and negative control (purple).](http://images.novusbio.com/images2/Rab25-Antibody-(3F12)-Flow-Cytometry-NBP1-51599-img0009.jpg)
![Immunohistochemistry-Paraffin: Rab25 Antibody (3F12) [NBP1-51599] - Analysis of esophagus tissues (left) and human lung cancer (right) using Rab25 mouse mAb with DAB staining.](http://images.novusbio.com/images2/Rab25-Antibody-(3F12)-Immunohistochemistry-Paraffin-NBP1-51599-img0007.jpg)
![Western Blot: Rab25 Antibody (3F12) [NBP1-51599] - Analysis using Rab25 mouse mAb against MCF-7 (1), T47D (2) and GC7901 (3) cell lysate.](http://images.novusbio.com/images2/Rab25-Antibody-(3F12)-Western-Blot-NBP1-51599-img0008.jpg)
![Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in NIH/3T3.](http://images.novusbio.com/images2/MARK2-Antibody-(3B12)-Western-Blot-H00002011-M01-img0010.jpg)
![ELISA: MARK2 Antibody (3B12) [H00002011-M01] - Detection limit for recombinant GST tagged MARK2 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/images2/MARK2-Antibody-(3B12)-ELISA-H00002011-M01-img0011.jpg)
![Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in PC-12.](http://images.novusbio.com/images2/MARK2-Antibody-(3B12)-Western-Blot-H00002011-M01-img0008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")