![Immunocytochemistry/Immunofluorescence: RAB11FIP2 Antibody [NBP1-82949] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://images.novusbio.com/fullsize2/RAB11FIP2 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82949-img0005.jpg "Immunocytochemistry/Immunofluorescence: RAB11FIP2 Antibody [NBP1-82949] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMN |
| Specificity | Specificity of human RAB11FIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB11FIP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 24372966). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82949 | Applications | Species |
|---|---|---|
| Schafer JC, Baetz NW, Lapierre LA et al. Rab11-FIP2 Interaction with MYO5B Regulates Movement of Rab11a-Containing Recycling Vesicles. Traffic 2014 Mar [PMID: 24372966] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB11FIP2 |
![Immunohistochemistry-Paraffin: RAB11FIP2 Antibody [NBP1-82949] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/RAB11FIP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82949-img0001.jpg "Immunohistochemistry-Paraffin: RAB11FIP2 Antibody [NBP1-82949] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: Rab11A Antibody [NBP2-49320] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue](http://images.novusbio.com/images2/Rab11A-Antibody-Western-Blot-NBP2-49320-img0003.jpg)
![Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.](http://images.novusbio.com/images2/Rab11A-Antibody-Immunohistochemistry-Paraffin-NBP2-49320-img0008.jpg)
![Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human colon shows moderate positivity in glandular cells.](http://images.novusbio.com/images2/Rab11A-Antibody-Immunohistochemistry-Paraffin-NBP2-49320-img0005.jpg)
![Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746] - Staining in human small intestine and skeletal muscle tissues. Corresponding MYO5B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Myosin-VB-Antibody-Immunohistochemistry-Paraffin-NBP1-87746-img0024.jpg)
![Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746] - Staining of human endometrium, placenta, skeletal muscle and small intestine using Anti-MYO5B antibody NBP1-87746 (A) shows similar protein distribution across tissues to independent antibody NBP1-87747 (B).](http://images.novusbio.com/images2/Myosin-VB-Antibody-Immunohistochemistry-Paraffin-NBP1-87746-img0033.jpg)
![Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/images2/Myosin-VB-Antibody-Immunohistochemistry-Paraffin-NBP1-87746-img0020.jpg)
![Western Blot: RAB11FIP5 Antibody [NBP1-81855] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/images2/RAB11FIP5-Antibody-Western-Blot-NBP1-81855-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: RAB11FIP5 Antibody [NBP1-81855] - Staining of human cell line A-431 shows localization to microtubule organizing center & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/RAB11FIP5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81855-img0008.jpg)
![Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP1-81855] - Staining in human testis and endometrium tissues using anti-RAB11FIP5 antibody. Corresponding RAB11FIP5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/RAB11FIP5-Antibody-Immunohistochemistry-Paraffin-NBP1-81855-img0011.jpg)
![Western Blot: RAB11FIP3 Antibody [NBP2-20034] - Sample (30 ug of whole cell lysate) A: U87-MG 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/RAB11FIP3 Antibody-Western Blot-NBP2-20034-img0001.jpg)
![Immunohistochemistry-Paraffin: RAB11FIP3 Antibody [NBP2-20034] - Human colon carcinoma, using RAB11FIP3 antibody at 1:500 dilution.Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.](http://images.novusbio.com/images2/RAB11FIP3 Antibody-Immunohistochemistry-Paraffin-NBP2-20034-img0002.jpg)
![Western Blot: EHD1 Antibody [NBP2-56035] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://images.novusbio.com/images2/EHD1 Antibody-Western Blot-NBP2-56035-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: EHD1 Antibody [NBP2-56035] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/images2/EHD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56035-img0001.jpg)
![Western Blot: FIP1/RCP Antibody (1A12B9D8) [NBP2-52546] - Analysis using RAB11FIP1 mouse mAb against Raji (1), SW620 (2), A431 (3), SW480 (4), HepG2 (5), Hela (6), and NIH3T3 (7) cell lysate.](http://images.novusbio.com/images2/FIP1-RCP-Antibody-(1A12B9D8)-Western-Blot-NBP2-52546-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: FIP1/RCP Antibody (1A12B9D8) [NBP2-52546] - Analysis of Hela cells using RAB11FIP1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.](http://images.novusbio.com/images2/FIP1-RCP-Antibody-(1A12B9D8)-Immunofluorescence-NBP2-52546-img0002.jpg)
![Immunohistochemistry-Paraffin: FIP1/RCP Antibody (1A12B9D8) [NBP2-52546] - Analysis of paraffin-embedded bladder cancer tissues using RAB11FIP1 mouse mAb with DAB staining.](http://images.novusbio.com/images2/FIP1-RCP-Antibody-(1A12B9D8)-Immunohistochemistry-Paraffin-NBP2-52546-img0004.jpg)
![Western Blot: EHD3 Antibody [NBP2-31896] - Analysis in human cell line NTERA-2.](http://images.novusbio.com/images2/EHD3-Antibody-Western-Blot-NBP2-31896-img0009.jpg)
![Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human lymphoid tissues shows moderate positivity in reticular fibers in germinal center cells.](http://images.novusbio.com/images2/EHD3-Antibody-Immunohistochemistry-Paraffin-NBP2-31896-img0008.jpg)
![Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.](http://images.novusbio.com/images2/EHD3-Antibody-Immunohistochemistry-Paraffin-NBP2-31896-img0005.jpg)
![Western Blot: Optineurin Antibody [NBP1-84682] - Analysis in human cell lines A-431 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.](http://images.novusbio.com/images2/Optineurin-Antibody-Western-Blot-NBP1-84682-img0018.jpg)
![Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).](http://images.novusbio.com/images2/Optineurin-Antibody-Western-Blot-NBP1-84682-img0023.jpg)
![Immunocytochemistry/Immunofluorescence: Optineurin Antibody [NBP1-84682] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining shown in green.](http://images.novusbio.com/images2/Optineurin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84682-img0012.jpg)
![Western Blot: Rab25 Antibody (3F12) [NBP1-51599] - Analysis using Rab25 mouse mAb against MCF-7 (1), T47D (2) and GC7901 (3) cell lysate.](http://images.novusbio.com/images2/Rab25-Antibody-(3F12)-Western-Blot-NBP1-51599-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Rab25 Antibody (3F12) [NBP1-51599] - Analysis of A549 cells using RAB25 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.](http://images.novusbio.com/images2/Rab25-Antibody-(3F12)-Immunocytochemistry-Immunofluorescence-NBP1-51599-img0010.jpg)
![Immunohistochemistry-Paraffin: Rab25 Antibody (3F12) [NBP1-51599] - Analysis of esophagus tissues (left) and human lung cancer (right) using Rab25 mouse mAb with DAB staining.](http://images.novusbio.com/images2/Rab25-Antibody-(3F12)-Immunohistochemistry-Paraffin-NBP1-51599-img0007.jpg)
![Western Blot: MARK2 [p Thr595] Antibody [NBP1-78028] - Lane 1: wild type Jurkat cells. Lane 2: wild type Jurkat cells stimulated with CD3/CD28 (T-cell receptor stimulation). Load: 35 ug per lane. Used at a dilution of 1:500 for overnight at 4C.](http://images.novusbio.com/images2/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0002.jpg)
![Western Blot: MARK2 [p Thr595] Antibody [NBP1-78028] - Lane 1: 293T cells untransfected. Lane 2: 293T cells transfected with MARK2 and PKC-zeta. Lane 3: 293T cells transfected with MARK2. Load: 35 ug per lane. Used at a dilution of 1:1000 for overnight at 4C.](http://images.novusbio.com/images2/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0001.jpg)
![Western Blot: CRCP Antibody [NBP1-84495] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 10. Lane 2: Human cell line RT-4.](http://images.novusbio.com/images2/CRCP-Antibody-Western-Blot-NBP1-84495-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: CRCP Antibody [NBP1-84495] - Staining of human cell line A-431 shows localization to nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/images2/CRCP Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84495-img0006.jpg)
![Immunohistochemistry-Paraffin: CRCP Antibody [NBP1-84495] - Staining of human testis shows cytoplasmic and nuclear positivity of cells in seminiferus ducts.](http://images.novusbio.com/images2/CRCP-Antibody-Immunohistochemistry-Paraffin-NBP1-84495-img0005.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")