![Immunocytochemistry/Immunofluorescence: RAB11FIP2 Antibody [NBP1-82949] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://images.novusbio.com/fullsize2/RAB11FIP2 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82949-img0005.jpg "Immunocytochemistry/Immunofluorescence: RAB11FIP2 Antibody [NBP1-82949] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMN |
| Specificity | Specificity of human RAB11FIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB11FIP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82949 | Applications | Species |
|---|---|---|
| Schafer JC, Baetz NW, Lapierre LA et al. Rab11-FIP2 Interaction with MYO5B Regulates Movement of Rab11a-Containing Recycling Vesicles. Traffic 2014 Mar [PMID: 24372966] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB11FIP2 |
![Immunohistochemistry-Paraffin: RAB11FIP2 Antibody [NBP1-82949] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/RAB11FIP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82949-img0001.jpg "Immunohistochemistry-Paraffin: RAB11FIP2 Antibody [NBP1-82949] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: Rab11A Antibody [NBP2-49320] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue](http://images.novusbio.com/fullsize2/Rab11A-Antibody-Western-Blot-NBP2-49320-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: Rab11A Antibody [NBP2-49320] - MDA MB 231 Cells, image courtesy of customer.](http://images.novusbio.com/fullsize2/Rab11A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49320-img0004.jpg)
![Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/Rab11A-Antibody-Immunohistochemistry-Paraffin-NBP2-49320-img0007.jpg)
![Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746] - Staining of human colon, kidney, lymph node and testis using Anti-MYO5B antibody NBP1-87746 (A) shows similar protein distribution across tissues to independent antibody NBP1-87747 (B).](http://images.novusbio.com/fullsize2/Myosin-VB-Antibody-Immunohistochemistry-Paraffin-NBP1-87746-img0032.jpg)
![Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize2/Myosin-VB-Antibody-Immunohistochemistry-Paraffin-NBP1-87746-img0018.jpg)
![Immunohistochemistry-Paraffin: Myosin VB Antibody [NBP1-87746] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Myosin-VB-Antibody-Immunohistochemistry-Paraffin-NBP1-87746-img0019.jpg)
![Western Blot: RAB11FIP5 Antibody [NBP1-81855] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize2/RAB11FIP5-Antibody-Western-Blot-NBP1-81855-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: RAB11FIP5 Antibody [NBP1-81855] - Staining of human cell line A-431 shows localization to microtubule organizing center & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/RAB11FIP5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81855-img0008.jpg)
![Immunohistochemistry-Paraffin: RAB11FIP5 Antibody [NBP1-81855] - Staining in human testis and endometrium tissues using anti-RAB11FIP5 antibody. Corresponding RAB11FIP5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/RAB11FIP5-Antibody-Immunohistochemistry-Paraffin-NBP1-81855-img0011.jpg)
![Immunohistochemistry-Paraffin: RAB11FIP3 Antibody [NBP1-83998] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/RAB11FIP3-Antibody-Immunohistochemistry-Paraffin-NBP1-83998-img0001.jpg)
![Western Blot: EHD1 Antibody [NBP2-56035] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://images.novusbio.com/fullsize2/EHD1 Antibody-Western Blot-NBP2-56035-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: EHD1 Antibody [NBP2-56035] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/EHD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56035-img0001.jpg)
![Western Blot: FIP1/RCP Antibody [NBP1-83600] - analysis in human cell lines A-431 and U-251MG using Anti-RAB11FIP1 antibody. Corresponding RAB11FIP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize2/FIP1-RCP-Antibody-Western-Blot-NBP1-83600-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: FIP1/RCP Antibody [NBP1-83600] - Staining of human cell line A-431 shows positivity in vesicles.](http://images.novusbio.com/fullsize2/FIP1-RCP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83600-img0008.jpg)
![Immunohistochemistry-Paraffin: FIP1/RCP Antibody [NBP1-83600] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize2/FIP1-RCP-Antibody-Immunohistochemistry-Paraffin-NBP1-83600-img0016.jpg)
![Western Blot: EHD3 Antibody (4B7) [H00030845-M01] - EHD3 monoclonal antibody (M01), clone 4B7 Analysis of EHD3 expression in IMR-32.](http://images.novusbio.com/fullsize2/EHD3-Antibody-(4B7)-Western-Blot-H00030845-M01-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: EHD3 Antibody (4B7) [H00030845-M01] - Analysis of monoclonal antibody to EHD3 on HeLa cell. Antibody concentration 25 ug/ml.](http://images.novusbio.com/fullsize2/EHD3-Antibody-(4B7)-Immunocytochemistry-Immunofluorescence-H00030845-M01-img0008.jpg)
![Immunohistochemistry-Paraffin: EHD3 Antibody (4B7) [H00030845-M01] - Analysis of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize2/EHD3-Antibody-(4B7)-Immunohistochemistry-Paraffin-H00030845-M01-img0010.jpg)
![Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).](http://images.novusbio.com/fullsize2/Optineurin-Antibody-Western-Blot-NBP1-84682-img0023.jpg)
![Immunocytochemistry/Immunofluorescence: Optineurin Antibody [NBP1-84682] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. Antibody staining shown in green.](http://images.novusbio.com/fullsize2/Optineurin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84682-img0012.jpg)
![Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize2/Optineurin-Antibody-Immunohistochemistry-Paraffin-NBP1-84682-img0016.jpg)
![Western Blot: Rab25 Antibody (3F12) [NBP1-51599] - Western blot analysis using Rab25 mouse mAb against MCF-7 (1), T47D (2) and GC7901 (3) cell lysate.](http://images.novusbio.com/fullsize2/Rab25-Antibody-(3F12)-Western-Blot-NBP1-51599-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Rab25 Antibody (3F12) [NBP1-51599] - Immunofluorescence analysis of A549 cells using RAB25 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.](http://images.novusbio.com/fullsize2/Rab25-Antibody-(3F12)-Immunocytochemistry-Immunofluorescence-NBP1-51599-img0010.jpg)
![Immunohistochemistry-Paraffin: Rab25 Antibody (3F12) [NBP1-51599] - Immunohistochemical analysis of paraffin-embedded esophagus tissues (left) and human lung cancer (right) using Rab25 mouse mAb with DAB staining.](http://images.novusbio.com/fullsize2/Rab25-Antibody-(3F12)-Immunohistochemistry-Paraffin-NBP1-51599-img0007.jpg)
![Western Blot: MARK2 [p Thr595] Antibody [NBP1-78028] - Lane 1: wild type Jurkat cells. Lane 2: wild type Jurkat cells stimulated with CD3/CD28 (T-cell receptor stimulation). Load: 35 ug per lane. Used at a dilution of 1:500 for overnight at 4C.](http://images.novusbio.com/fullsize2/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0002.jpg)
![Western Blot: MARK2 [p Thr595] Antibody [NBP1-78028] - Lane 1: 293T cells untransfected. Lane 2: 293T cells transfected with MARK2 and PKC-zeta. Lane 3: 293T cells transfected with MARK2. Load: 35 ug per lane. Used at a dilution of 1:1000 for overnight at 4C.](http://images.novusbio.com/fullsize2/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0001.jpg)
![Western Blot: CRCP Antibody [NBP1-84495] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 10. Lane 2: Human cell line RT-4.](http://images.novusbio.com/fullsize2/CRCP-Antibody-Western-Blot-NBP1-84495-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: CRCP Antibody [NBP1-84495] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.](http://images.novusbio.com/fullsize2/CRCP Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84495-img0006.jpg)
![Immunohistochemistry-Paraffin: CRCP Antibody [NBP1-84495] - Staining of human testis shows cytoplasmic and nuclear positivity of cells in seminiferus ducts.](http://images.novusbio.com/fullsize2/CRCP-Antibody-Immunohistochemistry-Paraffin-NBP1-84495-img0005.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")