Pyridoxal Kinase/PDXK Antibody


Western Blot: Pyridoxal Kinase/PDXK Antibody [NBP1-88284] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA more
Immunocytochemistry/ Immunofluorescence: Pyridoxal Kinase/PDXK Antibody [NBP1-88284] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88284] - Staining of human cerebral cortex shows strong positivity in neuronal cells and glial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF

Order Details

Pyridoxal Kinase/PDXK Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pyridoxal Kinase/PDXK Protein (NBP1-88284PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Pyridoxal Kinase/PDXK Antibody

  • C21orf124
  • C21orf97
  • chromosome 21 open reading frame 124
  • DKFZp566A071
  • EC
  • FLJ21324
  • FLJ37311
  • HEL-S-1a
  • MGC15873
  • MGC31754
  • MGC52346
  • PDXK
  • PKH
  • PKHchromosome 21 open reading frame 97
  • PNK
  • PNKhuman pyridoxal kinase, EC
  • PRED79
  • pyridoxal (pyridoxine, vitamin B6) kinase
  • Pyridoxal Kinase
  • pyridoxamine kinase
  • Pyridoxine kinase
  • Vitamin B6 Kinase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP, PLA
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for Pyridoxal Kinase/PDXK Antibody (NBP1-88284) (0)

There are no publications for Pyridoxal Kinase/PDXK Antibody (NBP1-88284).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pyridoxal Kinase/PDXK Antibody (NBP1-88284) (0)

There are no reviews for Pyridoxal Kinase/PDXK Antibody (NBP1-88284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pyridoxal Kinase/PDXK Antibody (NBP1-88284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Pyridoxal Kinase/PDXK Products

Bioinformatics Tool for Pyridoxal Kinase/PDXK Antibody (NBP1-88284)

Discover related pathways, diseases and genes to Pyridoxal Kinase/PDXK Antibody (NBP1-88284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pyridoxal Kinase/PDXK Antibody (NBP1-88284)

Discover more about diseases related to Pyridoxal Kinase/PDXK Antibody (NBP1-88284).

Pathways for Pyridoxal Kinase/PDXK Antibody (NBP1-88284)

View related products by pathway.

PTMs for Pyridoxal Kinase/PDXK Antibody (NBP1-88284)

Learn more about PTMs related to Pyridoxal Kinase/PDXK Antibody (NBP1-88284).

Blogs on Pyridoxal Kinase/PDXK

There are no specific blogs for Pyridoxal Kinase/PDXK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Pyridoxal Kinase/PDXK Antibody and receive a gift card or discount.


Gene Symbol PDXK