Pyridoxal Kinase/PDXK Antibody (5N4M3)

Western Blot: Pyridoxal Kinase/PDXK Antibody (5N4M3) [NBP3-33395] - Western blot analysis of various lysates, using Pyridoxal Kinase/PDXK Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5N4M3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Pyridoxal Kinase/PDXK Antibody (5N4M3) Summary

• Description: Novus Biologicals Rabbit Pyridoxal Kinase/PDXK Antibody (5N4M3) (NBP3-33395) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-312 of human Pyridoxal Kinase/PDXK (NP_003672.1).
  
  Sequence:
  MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PDXK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Pyridoxal Kinase/PDXK Antibody (5N4M3)

• C21orf124
• C21orf97
• chromosome 21 open reading frame 124
• DKFZp566A071
• EC 2.7.1.35
• FLJ21324
• FLJ37311
• HEL-S-1a
• MGC15873
• MGC31754
• MGC52346
• PDXK
• PKH
• PKHchromosome 21 open reading frame 97
• PNK
• PNKhuman pyridoxal kinase, EC 2.7.1.3510FLJ31940
• PRED79
• pyridoxal (pyridoxine, vitamin B6) kinase
• Pyridoxal Kinase
• pyridoxamine kinase
• Pyridoxine kinase
• Vitamin B6 Kinase

Background

Pyridoxal Kinase/PDXK is encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDXK