Pygopus-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Pygopus-1 Antibody [NBP1-86218] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Pygopus-1 Antibody [NBP1-86218] - Staining of human colon shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pygopus-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNSNFTSPLESNHSFIPPPNTFGQAKAPPPKQDFTQGATK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PYGO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pygopus-1 Protein (NBP1-86218PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pygopus-1 Antibody

  • DKFZp547G0910
  • Pygo1
  • pygopus 1
  • pygopus homolog 1 (Drosophila)
  • pygopus homolog 1
  • Pygopus1
  • Pygopus-1
  • pygopus-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3616
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF3996
Species: Hu
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-14350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF1620
Species: Mu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-35010
Species: Hu
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
423-F8/CF
Species: Hu, Mu
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
2547-FG/CF
Species: Hu
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86218
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Pygopus-1 Antibody (NBP1-86218) (0)

There are no publications for Pygopus-1 Antibody (NBP1-86218).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pygopus-1 Antibody (NBP1-86218) (0)

There are no reviews for Pygopus-1 Antibody (NBP1-86218). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Pygopus-1 Antibody (NBP1-86218) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pygopus-1 Products

Bioinformatics Tool for Pygopus-1 Antibody (NBP1-86218)

Discover related pathways, diseases and genes to Pygopus-1 Antibody (NBP1-86218). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pygopus-1 Antibody (NBP1-86218)

Discover more about diseases related to Pygopus-1 Antibody (NBP1-86218).
 

Pathways for Pygopus-1 Antibody (NBP1-86218)

View related products by pathway.

PTMs for Pygopus-1 Antibody (NBP1-86218)

Learn more about PTMs related to Pygopus-1 Antibody (NBP1-86218).

Blogs on Pygopus-1

There are no specific blogs for Pygopus-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pygopus-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PYGO1
Entrez