PYGL Antibody - BSA Free

Analysis in human cell lines PC-3 and SK-MEL-30 using Anti-PYGL antibody. Corresponding PYGL RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86147] - Analysis in human liver and pancreas tissues. Corresponding PYGL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86147] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86147] - Staining of human pancreas shows very weak positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86147] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86147] - Staining of human cerebral cortex shows very weak positivity in neuronal cells.

Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86147] - Staining of human testis shows very weak positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PYGL Antibody [NBP1-86147] - Staining of human bone marrow, cerebral cortex, liver and testis using Anti-PYGL antibody (A) NBP1-86147 shows similar protein distribution across tissues to independent antibody NBP1-86182 (B).

Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PYGL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PYGL Antibody - BSA Free (NBP1-86147) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLI
• Predicted Species: Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PYGL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PYGL Protein (NBP1-86147PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PYGL Antibody - BSA Free

• EC 2.4.1.1
• glycogen phosphorylase, liver form
• GSD6
• phosphorylase, glycogen, liver
• phosphorylase, glycogen; liver
• PYGL

Background

Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. Activity of phosphorylase is controlled both by allosteric means (through the noncovalent binding of metabolites) and by covalent modification. Thus AMP allosterically activates, whereas ATP, ADP, and glucose 6 phosphate allosterically inhibit, phosphorylase B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PYGL