PUS10 Antibody - BSA Free

Western Blot: PUS10 Antibody [NBP2-30613] - Analysis in control (vector only transfected HEK293T lysate) and PUS10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: PUS10 Antibody [NBP2-30613] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PUS10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVPIDGKSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNKQSVFTRMAVMKA
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PUS10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PUS10 Protein (NBP2-30613PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PUS10 Antibody - BSA Free

• CCDC139
• coiled-coil domain containing 139
• Coiled-coil domain-containing protein 139
• DOBIMGC126729
• EC 5.4.99
• EC 5.4.99.-
• FLJ32312
• MGC126755
• pseudouridine synthase 10
• pseudouridylate synthase 10
• Psi55 synthase
• PUS1
• putative tRNA pseudouridine synthase Pus10
• tRNA pseudouridine 55 synthase
• tRNA pseudouridylate synthase
• tRNA-uridine isomerase

Background

Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotidemodification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylatesynthases, such as PUS10, catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicingRNAs. These enzymes also act as RNA chaperones, facilitating the correct folding and assembly of tRNAs (McCleverty etal., 2007 (PubMed 17900615)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PUS10
• Uniprot:
  • Q3MIT2(Human)