PUS10 Antibody

Images

 
Western Blot: PUS10 Antibody [NBP2-30613] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: PUS10 Antibody [NBP2-30613] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PUS10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVPIDGKSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNKQSVFTRMAVMKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PUS10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PUS10 Protein (NBP2-30613PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PUS10 Antibody

  • CCDC139
  • coiled-coil domain containing 139
  • Coiled-coil domain-containing protein 139
  • DOBIMGC126729
  • EC 5.4.99
  • EC 5.4.99.-
  • FLJ32312
  • MGC126755
  • pseudouridine synthase 10
  • pseudouridylate synthase 10
  • Psi55 synthase
  • PUS1
  • putative tRNA pseudouridine synthase Pus10
  • tRNA pseudouridine 55 synthase
  • tRNA pseudouridylate synthase
  • tRNA-uridine isomerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-88826
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-80866
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF856
Species: Mu
Applications: WB, Flow, CyTOF-ready, Neut
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP2-31742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for PUS10 Antibody (NBP2-30613) (0)

There are no publications for PUS10 Antibody (NBP2-30613).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUS10 Antibody (NBP2-30613) (0)

There are no reviews for PUS10 Antibody (NBP2-30613). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PUS10 Antibody (NBP2-30613) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PUS10 Products

Bioinformatics Tool for PUS10 Antibody (NBP2-30613)

Discover related pathways, diseases and genes to PUS10 Antibody (NBP2-30613). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PUS10 Antibody (NBP2-30613)

Discover more about diseases related to PUS10 Antibody (NBP2-30613).
 

Pathways for PUS10 Antibody (NBP2-30613)

View related products by pathway.

PTMs for PUS10 Antibody (NBP2-30613)

Learn more about PTMs related to PUS10 Antibody (NBP2-30613).

Blogs on PUS10

There are no specific blogs for PUS10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PUS10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PUS10
Uniprot