STT3A Antibody (4D4)

Images

 
Western Blot: STT3A Antibody (4D4) [H00003703-M02] - Analysis of ITM1 expression in transfected 293T cell line by ITM1 monoclonal antibody (M02), clone 4D4.Lane 1: ITM1 transfected lysate(80.5 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: STT3A Antibody (4D4) [H00003703-M02] - Analysis of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
ELISA: STT3A Antibody (4D4) [H00003703-M02] - Detection limit for recombinant GST tagged ITM1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

STT3A Antibody (4D4) Summary

Immunogen
ITM1 (NP_689926 603 a.a. - 701 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
Localization
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Specificity
ITM1 - integral membrane protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STT3A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publications using H00003703-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STT3A Antibody (4D4)

  • Integral membrane protein 1EC 2.4.1.119
  • integral transmembrane protein 1
  • ITM1dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
  • MGC9042
  • Oligosaccharyl transferase subunit STT3A
  • STT3, subunit of the oligosaccharyltransferase complex, homolog A (S.cerevisiae)
  • STT3-AFLJ27038
  • TMCB5
  • transmembrane conserved
  • Transmembrane protein TMC

Background

Asparagine-linked glycosylation (ALG) is one of the most common protein modification reactions in eukaryotic cells, as many proteins that are translocated across or integrated into the rough endoplasmic reticulum (RER) carry N-linked oligosaccharides. STT3A is a subunit of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. SST3A seems to be involved in the complex substrate specificity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for STT3A Antibody (H00003703-M02)(2)

Reviews for STT3A Antibody (H00003703-M02) (0)

There are no reviews for STT3A Antibody (H00003703-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STT3A Antibody (H00003703-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STT3A Products

Bioinformatics Tool for STT3A Antibody (H00003703-M02)

Discover related pathways, diseases and genes to STT3A Antibody (H00003703-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STT3A Antibody (H00003703-M02)

Discover more about diseases related to STT3A Antibody (H00003703-M02).
 

Pathways for STT3A Antibody (H00003703-M02)

View related products by pathway.

PTMs for STT3A Antibody (H00003703-M02)

Learn more about PTMs related to STT3A Antibody (H00003703-M02).
 

Research Areas for STT3A Antibody (H00003703-M02)

Find related products by research area.

Blogs on STT3A

There are no specific blogs for STT3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STT3A Antibody (4D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol STT3A
Entrez
OMIM
Uniprot