NOLA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NOLA1 Antibody [NBP2-31742] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human lymph node shows strong nuclear positivity in non - germinal center cells.
Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOLA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT
Specificity
Specificity of human NOLA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reacivity reported in (PMID: 29695869).
Control Peptide
NOLA1 Protein (NBP2-31742PEP)
Publications
Read Publication using
NBP2-31742 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOLA1 Antibody

  • GAR1 ribonucleoprotein homolog (yeast)
  • H/ACA ribonucleoprotein complex subunit 1
  • NOLA1member 1 (H/ACA small nucleolar RNPs)
  • Nucleolar protein family A member 1
  • snoRNP protein GAR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13656
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-75472
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt, KD
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, ChIP, IHC, IHC-Fr, IHC-P, IP
NBP1-83140
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-73857
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-83837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOLA1 Antibody (NBP2-31742)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NOLA1 Antibody (NBP2-31742) (0)

There are no reviews for NOLA1 Antibody (NBP2-31742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOLA1 Antibody (NBP2-31742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NOLA1 Products

Bioinformatics Tool for NOLA1 Antibody (NBP2-31742)

Discover related pathways, diseases and genes to NOLA1 Antibody (NBP2-31742). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOLA1 Antibody (NBP2-31742)

Discover more about diseases related to NOLA1 Antibody (NBP2-31742).
 

Pathways for NOLA1 Antibody (NBP2-31742)

View related products by pathway.

PTMs for NOLA1 Antibody (NBP2-31742)

Learn more about PTMs related to NOLA1 Antibody (NBP2-31742).

Blogs on NOLA1

There are no specific blogs for NOLA1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOLA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAR1
Uniprot