NOLA1 Antibody

Immunocytochemistry/Immunofluorescence: NOLA1 Antibody [NBP2-31742] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human lymph node shows strong nuclear positivity in non - germinal center cells.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NOLA1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot reacivity reported in (PMID: 29695869).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NOLA1 Protein (NBP2-31742PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NOLA1 Antibody

• GAR1 ribonucleoprotein homolog (yeast)
• H/ACA ribonucleoprotein complex subunit 1
• NOLA1member 1 (H/ACA small nucleolar RNPs)
• Nucleolar protein family A member 1
• snoRNP protein GAR1

Background

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5. instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues. which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC. the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NOLA1 Antibody (NBP2-31742)(1)

Publication using NBP2-31742

• Nguyen THD, Tam J, Wu RA et al. Cryo-EM structure of substrate-bound human telomerase holoenzyme Nature 2018-05-01 [PMID: 29695869] (WB, Human)

Bioinformatics

• Gene Symbol: GAR1
• Uniprot:
  • Q9NY12(Human)