NOLA1 Antibody


Western Blot: NOLA1 Antibody [NBP2-31742] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver
Immunocytochemistry/ Immunofluorescence: NOLA1 Antibody [NBP2-31742] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human colon shows strong nuclear positivity in glandular, endothelial and ganglion cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NOLA1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT
Specificity of human NOLA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOLA1 Protein (NBP2-31742PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NOLA1 Antibody

  • GAR1 ribonucleoprotein homolog (yeast)
  • H/ACA ribonucleoprotein complex subunit 1
  • NOLA1member 1 (H/ACA small nucleolar RNPs)
  • Nucleolar protein family A member 1
  • snoRNP protein GAR1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, PLA
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOLA1 Antibody (NBP2-31742) (0)

There are no publications for NOLA1 Antibody (NBP2-31742).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOLA1 Antibody (NBP2-31742) (0)

There are no reviews for NOLA1 Antibody (NBP2-31742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOLA1 Antibody (NBP2-31742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NOLA1 Products

Bioinformatics Tool for NOLA1 Antibody (NBP2-31742)

Discover related pathways, diseases and genes to NOLA1 Antibody (NBP2-31742). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOLA1 Antibody (NBP2-31742)

Discover more about diseases related to NOLA1 Antibody (NBP2-31742).

Pathways for NOLA1 Antibody (NBP2-31742)

View related products by pathway.

PTMs for NOLA1 Antibody (NBP2-31742)

Learn more about PTMs related to NOLA1 Antibody (NBP2-31742).

Blogs on NOLA1

There are no specific blogs for NOLA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NOLA1 Antibody and receive a gift card or discount.


Gene Symbol GAR1