NOLA1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NOLA1 Antibody [NBP2-31742] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human lymph node shows strong nuclear positivity in non - germinal center cells.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: NOLA1 Antibody [NBP2-31742] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NOLA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NOLA1 Antibody - BSA Free (NBP2-31742) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-NOLA1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:100
  • Western Blot Reacivity reported in (PMID: 29695869)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation: Tested in A-375, HT-1080, separated by Size, antibody dilution of 1:100
• Control Peptide:

  NOLA1 Protein (NBP2-31742PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NOLA1 Antibody - BSA Free

• GAR1 ribonucleoprotein homolog (yeast)
• H/ACA ribonucleoprotein complex subunit 1
• NOLA1member 1 (H/ACA small nucleolar RNPs)
• Nucleolar protein family A member 1
• snoRNP protein GAR1

Background

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5. instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues. which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC. the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NOLA1 Antibody (NBP2-31742)(3)

Publications using NBP2-31742

• Malinski B, Vertemara J, Faustini E et al. Novel pathological variants of NHP2 affect N-terminal domain flexibility, protein stability, H/ACA RNP complex formation and telomerase activity Human molecular genetics 2023-07-13 [PMID: 37440454] (WB, Human)
• Zyner KG, Mulhearn DS, Adhikari S, Martínez Cuesta S et Al. Genetic interactions of G-quadruplexes in humans Elife 2019-07-10 [PMID: 31287417]
• Nguyen THD, Tam J, Wu RA et al. Cryo-EM structure of substrate-bound human telomerase holoenzyme Nature 2018-05-01 [PMID: 29695869] (WB, Human)

Bioinformatics

• Gene Symbol: GAR1
• Uniprot:
  • Q9NY12(Human)