Puromycin-sensitive aminopeptidase/NPEPPS Antibody - BSA Free

Western Blot: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-88103] - Host: Rabbit. Target Name: NPEPPS. Sample Tissue: Human Ovary Tumor. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Puromycin-sensitive aminopeptidase/NPEPPS Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Puromycin-sensitive aminopeptidase/NPEPPS. Peptide sequence: FDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPEPPS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Puromycin-sensitive aminopeptidase/NPEPPS Antibody - BSA Free

• AAP-S
• aminopeptidase puromycin sensitive
• Cytosol alanyl aminopeptidase
• EC 3.4.11.2
• EC 3.4.11.3
• metalloproteinase MP100
• MP100
• MP100EC 3.4.11
• NPEPPS
• PSAEC 3.4.11.14
• puromycin-sensitive aminopeptidase

Background

NPEPPS encodes the puromycin-sensitive aminopeptidase, a zinc metallopeptidase which hydrolyzes amino acids from the N-terminus of its substrate. The protein has been localized to both the cytoplasm and to cellular membranes. This enzyme degrades enkaphalins in the brain, and studies in mouse suggest that it is involved in proteolytic events regulating the cell cycle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPEPPS