![Immunocytochemistry/Immunofluorescence: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.](http://images.novusbio.com/fullsize2/Puromycin-sensitive-aminopeptidase-NPEPPS-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13669-img0003.jpg "Immunocytochemistry/Immunofluorescence: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQA DMQEEKNRIERVLGATLLPDLIQKVLTFALSE |
| Specificity | Specificity of human Puromycin-sensitive aminopeptidase/NPEPPS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPEPPS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
PTMs for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)Learn more about PTMs related to Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPEPPS |
![Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells and in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/Puromycin-sensitive-aminopeptidase-NPEPPS-Antibody-Immunohistochemistry-Paraffin-NBP2-13669-img0008.jpg "Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells and in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/Puromycin-sensitive-aminopeptidase-NPEPPS-Antibody-Immunohistochemistry-Paraffin-NBP2-13669-img0004.jpg "Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Puromycin-sensitive-aminopeptidase-NPEPPS-Antibody-Immunohistochemistry-Paraffin-NBP2-13669-img0005.jpg "Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Puromycin-sensitive-aminopeptidase-NPEPPS-Antibody-Immunohistochemistry-NBP2-13669-img0006.jpg "Immunohistochemistry: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/Puromycin-sensitive-aminopeptidase-NPEPPS-Antibody-Immunohistochemistry-Paraffin-NBP2-13669-img0007.jpg "Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.")
![Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi](http://images.novusbio.com/images2/Androgen-R-NR3C4-[p-Ser213--p-Ser210]-Antibody-(156C135.2)-Western-Blot-NB100-56603-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/AKR1B1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89146-img0006.jpg)
![Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/images2/AKR1B1-Antibody-Immunohistochemistry-Paraffin-NBP1-89146-img0016.jpg)
![Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/images2/AKR1B1-Antibody-Immunohistochemistry-Paraffin-NBP1-89146-img0010.jpg)
![Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).](http://images.novusbio.com/images2/Ferredoxin-Reductase-Antibody-Western-Blot-NBP2-38530-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/images2/Ferredoxin-Reductase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38530-img0001.jpg)
![Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and lymph node tissues using NBP2-38530 antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Ferredoxin-Reductase-Antibody-Immunohistochemistry-Paraffin-NBP2-38530-img0019.jpg)
![Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/images2/Adenine-Nucleotide-Translocator-2-Antibody-Western-Blot-NBP2-57642-img0002.jpg)
![Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/Adenine-Nucleotide-Translocator-2-Antibody-Immunohistochemistry-Paraffin-NBP2-57642-img0004.jpg)
![Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells and cells in granular layer.](http://images.novusbio.com/images2/Adenine-Nucleotide-Translocator-2-Antibody-Immunohistochemistry-Paraffin-NBP2-57642-img0003.jpg)
![Western Blot: PAG3 Antibody [NBP2-24614] - Analysis of ASAP2 in human brain lysate using 1) preimmune sera at 1:5000 and 2) protein A purified this antibody. 1.0 ug/ml.](http://images.novusbio.com/images2/PAG3-Antibody-Western-Blot-NBP2-24614-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: PAPOLA Antibody [NBP1-87345] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/images2/PAPOLA Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87345-img0011.jpg)
![Immunohistochemistry-Paraffin: PAPOLA Antibody [NBP1-87345] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/images2/PAPOLA-Antibody-Immunohistochemistry-Paraffin-NBP1-87345-img0009.jpg)
![Western Blot: MRPS30 Antibody [NBP2-94408] - Analysis of 200ug extracts of HepG2 cells using MRPS30 at a dilition of 1:1000.](http://images.novusbio.com/images2/MRPS30-Antibody-Western-Blot-NBP2-94408-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: MRPS30 Antibody [NBP2-94408] - Analysis of U2OS cells using MRPS30. Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/MRPS30-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94408-img0001.jpg)
![Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP2-94408] - Paraffin-embedded rat lung using MRPS30.](http://images.novusbio.com/images2/MRPS30-Antibody-Immunohistochemistry-Paraffin-NBP2-94408-img0003.jpg)
![Western Blot: ASAP1 Antibody [NBP2-24643] - Analysis of ASAP1 in mouse brain lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24643 at 2.0 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/ASAP1-Antibody-Western-Blot-NBP2-24643-img0001.jpg)
![Western Blot: TUSC2 Antibody [NBP1-86794] - Analysis in control (vector only transfected HEK293T lysate) and TUSC2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/TUSC2-Antibody-Western-Blot-NBP1-86794-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: TUSC2 Antibody [NBP1-86794] - Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.](http://images.novusbio.com/images2/TUSC2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86794-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: PDAP1 Antibody [NBP2-38621] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.](http://images.novusbio.com/images2/PDAP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38621-img0001.jpg)
![Immunohistochemistry-Paraffin: PDAP1 Antibody [NBP2-38621] - Staining of human tonsil shows cytoplasmic positivity mainly in germinal center cells.](http://images.novusbio.com/images2/PDAP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38621-img0004.jpg)
![Western Blot: Reg3A Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/Reg3a-Antibody-Western-Blot-NBP2-24763-img0004.jpg)
![Immunohistochemistry-Paraffin: Reg3A Antibody [NBP2-24763] - Human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.](http://images.novusbio.com/images2/Reg3a-Antibody-Immunohistochemistry-Paraffin-NBP2-24763-img0003.jpg)
![Western Blot: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - PSMA expression in human prostate cancer cell lines. Image from verified customer review.](http://images.novusbio.com/images2/PSMA-FOLH1-NAALADase-I-Antibody-(GCP-04)-Western-Blot-NBP1-45057-img0010.jpg)
![Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - GCPII in porcine kidney by GCP-04 monoclonal antibody. Highly positive proximal glomeruli.](http://images.novusbio.com/images2/PSMA-FOLH1-NAALADase-I-Antibody-(GCP-04)-Immunohistochemistry-Paraffin-NBP1-45057-img0008.jpg)
![Western Blot: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - Fragment of human GCPII (aminoacids 44-750) produced in S2 cells on Western blot by GCP-04 monoclonal antibody. Lanes 1, 2, 3 represent 800, 400 and 200 pg of the protein.](http://images.novusbio.com/images2/PSMA-FOLH1-NAALADase-I-Antibody-(GCP-04)-Western-Blot-NBP1-45057-img0009.jpg)
![Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - Formalin-fixed, paraffin-embedded human colon Ganglion stained with CD56 Monoclonal Antibody (123C3.D5)](http://images.novusbio.com/images2/NCAM-1-CD56-Antibody-(123C3.D5)-Immunohistochemistry-Paraffin-NBP2-15184-img0016.jpg)
![Flow (Cell Surface): NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - A surface stain was performed on U-87 Cells with NCAM-1/CD56 Antibody (123C3) NBP2-33132B and a matched isotype control. Both antibodies were conjugated to biotin. Cells were incubated in an antibody dilution of 5 ug/mL for 20 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).](http://images.novusbio.com/images2/NCAM-1-CD56-Antibody-(123C3.D5)-Flow-(Cell-Surface)-NBP2-15184-img0018.jpg)
![Flow Cytometry: NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - analysis of CD56 on human monocytes using CD56 antibody at 1 ug/10^6 cells.](http://images.novusbio.com/images2/NCAM-1-CD56-Antibody-(123C3.D5)-Flow-Cytometry-NBP2-15184-img0004.jpg)
![Western Blot: ACAT1 Antibody [NBP1-89284] - Analysis using Anti-ACAT1 antibody NBP1-89284 (A) shows similar pattern to independent antibody NBP1-89285 (B).](http://images.novusbio.com/images2/ACAT1 Antibody-Western Blot-NBP1-89284-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/images2/ACAT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89284-img0007.jpg)
![Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human cerebellum shows moderate positivity in mitochondria in Purkinje cells.](http://images.novusbio.com/images2/ACAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-89284-img0014.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")