![Immunocytochemistry/Immunofluorescence: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.](http://images.novusbio.com/fullsize2/Puromycin-sensitive-aminopeptidase-NPEPPS-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13669-img0003.jpg "Immunocytochemistry/Immunofluorescence: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQA DMQEEKNRIERVLGATLLPDLIQKVLTFALSE |
| Specificity | Specificity of human Puromycin-sensitive aminopeptidase/NPEPPS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPEPPS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
PTMs for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)Learn more about PTMs related to Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/Puromycin-sensitive aminopeptidase-NPEPPS Antibody-Immunohistochemistry-Paraffin-NBP2-13669-img0004.jpg "Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi](http://images.novusbio.com/fullsize2/Androgen-R-NR3C4-[p-Ser213--p-Ser210]-Antibody-(156C135.2)-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: AKR1B1 Antibody [NBP1-89146] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/AKR1B1-Antibody-Western-Blot-NBP1-89146-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize2/AKR1B1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89146-img0006.jpg)
![Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/AKR1B1-Antibody-Immunohistochemistry-Paraffin-NBP1-89146-img0011.jpg)
![Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize2/Ferredoxin-Reductase-Antibody-Western-Blot-NBP2-38530-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria.](http://images.novusbio.com/fullsize2/Ferredoxin-Reductase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38530-img0001.jpg)
![Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and pancreas tissues using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Ferredoxin-Reductase-Antibody-Immunohistochemistry-Paraffin-NBP2-38530-img0006.jpg)
![Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-56762] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/Adenine Nucleotide Translocator 2 Antibody-Western Blot-NBP2-56762-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-56762] - Staining of human cell line PC-3 shows localization to mitochondria.](http://images.novusbio.com/fullsize2/Adenine-Nucleotide-Translocator-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56762-img0001.jpg)
![Western Blot: PAG3 Antibody [NBP2-24614] - Analysis of ASAP2 in human brain lysate using 1) preimmune sera at 1:5000 and 2) protein A purified this antibody. 1.0 ug/ml.](http://images.novusbio.com/fullsize2/PAG3-Antibody-Western-Blot-NBP2-24614-img0001.jpg)
![Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/MRPS30-Antibody-Western-Blot-NBP1-87343-img0006.jpg)
![Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/MRPS30-Antibody-Immunohistochemistry-Paraffin-NBP1-87343-img0010.jpg)
![Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://images.novusbio.com/fullsize2/MRPS30-Antibody-Western-Blot-NBP1-87343-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Analysis of phosphorylated ASAP1present in mouse NIH3T3 cells transfected with activated Src. Specific staining is not present when antibody is pre-incubated with the immunizing peptide prior to reaction with cells.](http://images.novusbio.com/fullsize2/ASAP1 [p Tyr782] Antibody-Immunocytochemistry-Immunofluorescence-NBP1-77933-img0005.jpg)
![Immunohistochemistry: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Used at 20 g/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate intracellular positive staining in epidermal keratinocytes in human skin at 40X. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain. Personal Communication, Tina Roush, LifeSpanBiosciences, Seattle, WA.](http://images.novusbio.com/fullsize2/ASAP1-[p-Tyr782]-Antibody-Immunohistochemistry-NBP1-77933-img0004.jpg)
![Western Blot: Reg3a Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/fullsize2/Reg3a-Antibody-Western-Blot-NBP2-24763-img0004.jpg)
![Immunohistochemistry-Paraffin: Reg3a Antibody [NBP2-24763] - Formalin-fixed, paraffin-embedded human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.](http://images.novusbio.com/fullsize2/Reg3a-Antibody-Immunohistochemistry-Paraffin-NBP2-24763-img0003.jpg)
![Western Blot: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - PSMA expression in human prostate cancer cell lines. Image from verified customer review.](http://images.novusbio.com/fullsize2/PSMA-FOLH1-NAALADase-I-Antibody-(GCP-04)-Western-Blot-NBP1-45057-img0010.jpg)
![Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - GCPII in porcine kidney by GCP-04 monoclonal antibody. Highly positive proximal glomeruli.](http://images.novusbio.com/fullsize2/PSMA-FOLH1-NAALADase-I-Antibody-(GCP-04)-Immunohistochemistry-Paraffin-NBP1-45057-img0008.jpg)
![Western Blot: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - Fragment of human GCPII (aminoacids 44-750) produced in S2 cells on Western blot by GCP-04 monoclonal antibody. Lanes 1, 2, 3 represent 800, 400 and 200 pg of the protein.](http://images.novusbio.com/fullsize2/PSMA-FOLH1-NAALADase-I-Antibody-(GCP-04)-Western-Blot-NBP1-45057-img0009.jpg)
![Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - Formalin-fixed, paraffin-embedded human colon Ganglion stained with CD56 Monoclonal Antibody (123C3.D5)](http://images.novusbio.com/fullsize2/NCAM-1-CD56-Antibody-(123C3-(same-as-123C3.D5))-Immunohistochemistry-Paraffin-NBP2-15184-img0016.jpg)
![Flow Cytometry: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - Analysis of Alexa Fluor (R) 700 conjugate of NBP2-15184. CD56 in human PBMC using anti-CD56 antibody. The primary antibody was used at a dilution of 1:100, incubated for 25 min at 4C in 2% human serum, 0.5 mM EDTA in DPBS. Image from verified customer rev](http://images.novusbio.com/fullsize2/NCAM-1-CD56-Antibody-(123C3-(same-as-123C3.D5))-Flow-Cytometry-NBP2-15184-img0015.jpg)
![Flow Cytometry: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - analysis of CD56 on human monocytes using CD56 antibody at 1 ug/10^6 cells.](http://images.novusbio.com/fullsize2/NCAM-1-CD56-Antibody-(123C3-(same-as-123C3.D5))-Flow-Cytometry-NBP2-15184-img0004.jpg)
![Western Blot: ACAT1 Antibody [NBP1-89284] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize2/ACAT1-Antibody-Western-Blot-NBP1-89284-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize2/ACAT1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89284-img0007.jpg)
![Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/ACAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-89284-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: POMT1 Antibody [NBP2-57200] - Staining of human cell line MCF7 shows localization to the Golgi apparatus.](http://images.novusbio.com/fullsize2/POMT1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57200-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")