Home » Puromycin-sensitive aminopeptidase/NPEPPS » Puromycin-sensitive aminopeptidase Antibodies » Puromycin-sensitive aminopeptidase/NPEPPS Antibody

Puromycin-sensitive aminopeptidase/NPEPPS Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunocytochemistry/ Immunofluorescence: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells and in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Puromycin-sensitive aminopeptidase/NPEPPS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQA DMQEEKNRIERVLGATLLPDLIQKVLTFALSE
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPEPPS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Puromycin-sensitive aminopeptidase/NPEPPS Protein (NBP2-13669PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Puromycin-sensitive aminopeptidase/NPEPPS Antibody

  • AAP-S
  • aminopeptidase puromycin sensitive
  • Cytosol alanyl aminopeptidase
  • EC 3.4.11.2
  • EC 3.4.11.3
  • metalloproteinase MP100
  • MP100
  • MP100EC 3.4.11
  • NPEPPS
  • PSAEC 3.4.11.14
  • puromycin-sensitive aminopeptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(16 Publications)
Species: Hu
Applications: ELISA
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Amphiregulin
[Biotin]
DY262
(1 Review)
(38 Publications)
Species: Hu
Applications: ELISA
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded mouse heart using Adenine Nucleotide Translocator 2 .
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PAG3 Antibody
NBP2-24614
Western Blot: PAG3 Antibody [NBP2-24614] - Analysis of ASAP2 in human brain lysate using 1) preimmune sera at 1:5000 and 2) protein A purified this antibody. 1.0 ug/ml.
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
PAPOLA Antibody
NBP1-87345
Immunohistochemistry-Paraffin: PAPOLA Antibody [NBP1-87345] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: PAPOLA Antibody [NBP1-87345] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MRPS30 Antibody
NBP1-87343
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human breast shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human thyroid gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ASAP1 Antibody
NBP2-48909
Immunohistochemistry-Paraffin: ASAP1 Antibody [NBP2-48909] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Knockout Validated: ASAP1 Antibody [NBP2-48909] - Loss of ASAP1 results in expansion of the hypertrophic zone. E15.5 Asap1+/+ (Q,R) and Asap1GT/GT (S,T). ASAP1 immunostaining indicates specific expression of ASAP1 in the perichondrium, in late hypertrophic chondrocytes and in the primary ossification center. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pgen.1008216) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: ASAP1 Antibody [NBP2-48909] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
TUSC2 Antibody
NBP3-04411
Immunohistochemistry-Paraffin: TUSC2 Antibody [NBP3-04411] - Paraffin-embedded rat brain using TUSC2 antibody at dilution of 1:200 (40x lens).
Immunohistochemistry-Paraffin: TUSC2 Antibody [NBP3-04411] - Paraffin-embedded mouse kidney using TUSC2 antibody at dilution of 1:200 (40x lens).
Immunohistochemistry-Paraffin: TUSC2 Antibody [NBP3-04411] - Paraffin-embedded mouse heart using TUSC2 antibody at dilution of 1:200 (40x lens).
Species: Hu, Mu, Rt
Applications: IHC, WB
PDAP1 Antibody
NBP2-38621
Immunocytochemistry/Immunofluorescence: PDAP1 Antibody [NBP2-38621] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: PDAP1 Antibody [NBP2-38621] - Staining of human tonsil shows cytoplasmic positivity mainly in germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Reg3A Antibody
NBP2-24763
Western Blot: Reg3A Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Reg3A Antibody [NBP2-24763] - Human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.
(3 Publications)
Species: Hu, Pm
Applications: IHC, IHC-P, WB

PSMA/FOLH1/NAALADase I ...
NBP1-45057
Western Blot: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - Analysis of human PSMA using mouse monoclonal antibody GCP-04 on lysates of LNCaP cell line and Jurkat cell line (PSMA non-expressing cell line; negative control) under reducing and non-reducing conditions. Nitrocellulose membrane was probed with 2 ug/ml of mouse anti-PSMA monoclonal antibody followed by IRDye800-conjugated anti-mouse secondary antibody.
Immunohistochemistry: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - GCPII in human Medulla oblongata by GCP-04 monoclonal antibody. Mag. 40x; positive astrocytes in white matter.
Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody (GCP-04) [NBP1-45057] - GCPII in human prostate by GCP-04 monoclonal antibody. Mag. 400x; positive epithelium of the prostate glands.
(2 Reviews)
(8 Publications)
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Kallikrein 2
Antibody
NBP1-06046
Western Blot: Kallikrein 2 Antibody [NBP1-06046] - Staining of HeLa cell lysate (A) + peptide (B) (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Kallikrein 2 Antibody [NBP1-06046] - Staining of paraffin embedded Human Prostate. Antibody at 8 ug/mL. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
Immunohistochemistry-Paraffin: Kallikrein 2 Antibody [NBP1-06046] - Negative Control showing staining of paraffin embedded Human Prostate, with no primary antibody.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NCAM-1/CD56
Antibody (123C3.D5)
NBP2-15184
Flow Cytometry: NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - analysis of CD56 on human monocytes using CD56 antibody at 1 ug/10^6 cells.
Simple Western: NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - Simple Western lane view shows a specific band for NCAM-1/CD56 in 0.2 mg/ml of IMR-32 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - Electropherogram image of the corresponding Simple Western lane. NCAM-1/CD56 antibody was used at 10 ug/ml dilution of IMR-32 lysates(s) respectively.
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, Simple Western
ACAT1 Antibody
NBP1-89284
Western Blot: ACAT1 Antibody [NBP1-89284] - ACAT1 porcine cerebral cortex. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human cerebellum, kidney, liver and testis using Anti-ACAT1 antibody NBP1-89284 (A) shows similar protein distribution across tissues to independent antibody NBP1-89285 (B).
(1 Review)
(5 Publications)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
POMT1 Antibody
NBP3-12487
Immunohistochemistry-Paraffin: POMT1 Antibody [NBP3-12487] - 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40x magnification.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB

Puromycin-sensitive am ...
NBP2-13669
Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669) (0)

There are no publications for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669) (0)

There are no reviews for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Puromycin-sensitive aminopeptidase/NPEPPS Products

Bioinformatics Tool for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)

Discover related pathways, diseases and genes to Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)

Discover more about diseases related to Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669).
 

Pathways for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)

View related products by pathway.

PTMs for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)

Learn more about PTMs related to Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669).

Blogs on Puromycin-sensitive aminopeptidase/NPEPPS

There are no specific blogs for Puromycin-sensitive aminopeptidase/NPEPPS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Puromycin-sensitive aminopeptidase/NPEPPS Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NPEPPS