Puromycin-sensitive aminopeptidase/NPEPPS Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Puromycin-sensitive aminopeptidase/NPEPPS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQA DMQEEKNRIERVLGATLLPDLIQKVLTFALSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPEPPS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Puromycin-sensitive aminopeptidase/NPEPPS Protein (NBP2-13669PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Puromycin-sensitive aminopeptidase/NPEPPS Antibody

  • AAP-S
  • aminopeptidase puromycin sensitive
  • Cytosol alanyl aminopeptidase
  • EC 3.4.11.2
  • EC 3.4.11.3
  • metalloproteinase MP100
  • MP100
  • MP100EC 3.4.11
  • NPEPPS
  • PSAEC 3.4.11.14
  • puromycin-sensitive aminopeptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-13669
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669) (0)

There are no publications for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669) (0)

There are no reviews for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Puromycin-sensitive aminopeptidase/NPEPPS Products

Bioinformatics Tool for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)

Discover related pathways, diseases and genes to Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)

Discover more about diseases related to Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669).
 

Pathways for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)

View related products by pathway.

PTMs for Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669)

Learn more about PTMs related to Puromycin-sensitive aminopeptidase/NPEPPS Antibody (NBP2-13669).

Blogs on Puromycin-sensitive aminopeptidase/NPEPPS

There are no specific blogs for Puromycin-sensitive aminopeptidase/NPEPPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Puromycin-sensitive aminopeptidase/NPEPPS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPEPPS
Entrez