Puromycin-sensitive aminopeptidase/NPEPPS Antibody

Immunocytochemistry/Immunofluorescence: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.

Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells and in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Puromycin-sensitive aminopeptidase/NPEPPS Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKVLTFALSE
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPEPPS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Puromycin-sensitive aminopeptidase/NPEPPS Protein (NBP2-13669PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Puromycin-sensitive aminopeptidase/NPEPPS Antibody

• AAP-S
• aminopeptidase puromycin sensitive
• Cytosol alanyl aminopeptidase
• EC 3.4.11.2
• EC 3.4.11.3
• metalloproteinase MP100
• MP100
• MP100EC 3.4.11
• NPEPPS
• PSAEC 3.4.11.14
• puromycin-sensitive aminopeptidase

Background

NPEPPS encodes the puromycin-sensitive aminopeptidase, a zinc metallopeptidase which hydrolyzes amino acids from the N-terminus of its substrate. The protein has been localized to both the cytoplasm and to cellular membranes. This enzyme degrades enkaphalins in the brain, and studies in mouse suggest that it is involved in proteolytic events regulating the cell cycle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPEPPS