PUM2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PUM2 Antibody [NBP1-89623] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PUM2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQF
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PUM2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PUM2 Protein (NBP1-89623PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PUM2 Antibody - BSA Free

• FLJ36528
• KIAA0235PUMH2PUML2
• MGC138251
• MGC138253
• PUM2
• PUMH2
• pumilio (Drosphila) homolog 2
• pumilio homolog 2 (Drosophila)
• pumilio homolog 2
• Pumilio-2
• PUML2

Background

Pumilio 2 is a component of conserved cellular machinery required for germ cell development, Pum2 is a human homolog of Pumilio, which helps maintain germ line stem cells in Drosophila and C. elegans. Pum2 forms a stable complex with DAZ through the same functional domain required for RNA binding and protein-protein interactions. Pum2 is expressed predominantly in human embryonic stem cells and germ cells and colocalizes with DAZ and DAZL in germ cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PUM2