PUM2 Antibody


Western Blot: PUM2 Antibody [NBP1-89623] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: PUM2 Antibody [NBP1-89623] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PUM2 Antibody [NBP1-89623] - Staining of human thyroid gland shows distinct cytoplasmic positivity in glandular cells.
Western Blot: PUM2 Antibody [NBP1-89623] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-452
Immunohistochemistry-Paraffin: PUM2 Antibody [NBP1-89623] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PUM2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQF
Specificity of human, mouse, rat PUM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PUM2 Protein (NBP1-89623PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PUM2 Antibody

  • FLJ36528
  • MGC138251
  • MGC138253
  • PUM2
  • PUMH2
  • pumilio (Drosphila) homolog 2
  • pumilio homolog 2 (Drosophila)
  • pumilio homolog 2
  • Pumilio-2
  • PUML2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, GS, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq, Gt, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for PUM2 Antibody (NBP1-89623) (0)

There are no publications for PUM2 Antibody (NBP1-89623).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUM2 Antibody (NBP1-89623) (0)

There are no reviews for PUM2 Antibody (NBP1-89623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PUM2 Antibody (NBP1-89623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PUM2 Products

Bioinformatics Tool for PUM2 Antibody (NBP1-89623)

Discover related pathways, diseases and genes to PUM2 Antibody (NBP1-89623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PUM2 Antibody (NBP1-89623)

Discover more about diseases related to PUM2 Antibody (NBP1-89623).

Pathways for PUM2 Antibody (NBP1-89623)

View related products by pathway.

PTMs for PUM2 Antibody (NBP1-89623)

Learn more about PTMs related to PUM2 Antibody (NBP1-89623).

Research Areas for PUM2 Antibody (NBP1-89623)

Find related products by research area.

Blogs on PUM2

There are no specific blogs for PUM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PUM2 Antibody and receive a gift card or discount.


Gene Symbol PUM2