PTP gamma/PTPRG Antibody - BSA Free

Immunohistochemistry-Paraffin: PTP gamma/PTPRG Antibody [NBP2-57477] - Immunohistochemical staining of human duodenum shows strong membranous positivity in endothelial cells and weak in a subset of immune cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PTP gamma/PTPRG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PTP gamma/PTPRG Antibody - BSA Free (NBP2-57477) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVS
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPRG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PTP gamma/PTPRG Recombinant Protein Antigen (NBP2-57477PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PTP gamma/PTPRG Antibody - BSA Free

• EC 3.1.3.48
• H_RG317H01.1
• HPTPG
• protein tyrosine phosphatase, receptor type, G
• protein tyrosine phosphatase, receptor type, gamma polypeptide
• Protein-tyrosine phosphatase gamma
• PTP gamma
• PTPG
• PTPGprotein tyrosine phosphatase gamma
• PTPRG
• receptor type protein tyrosine phosphatase gamma
• receptor tyrosine phosphatase gamma
• receptor-type protein phosphatase gamma
• receptor-type tyrosine-protein phosphatase gamma
• RPTPG
• R-PTP-GAMMA

Background

PTPRG is encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region of this PTP contains a carbonic anhydrase-like (CAH) domain, which is also found in the extracellular region of PTPRBETA/ZETA. This gene is located in a chromosomal region that is frequently deleted in renal cell carcinoma and lung carcinoma, thus is thought to be a candidate tumor suppressor gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPRG