PTPRD Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PTPRD Antibody [NBP2-49153] - Immunofluorescent staining of human cell line RH-30 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human skin shows no positivity in keratinocytes as expected.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human adrenal gland shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPRD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE
Specificity
Specificity of human PTPRD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTPRD Recombinant Protein Antigen (NBP2-49153PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTPRD Antibody

  • HPTPDELTA
  • HPTPMGC119752
  • MGC119750
  • MGC119751
  • protein tyrosine phosphatase, receptor type, D
  • Protein-tyrosine phosphatase delta
  • PTP delta
  • PTPD
  • PTPdelta
  • PTP-delta
  • PTPDMGC119753
  • PTPRD
  • receptor type, delta polypeptide
  • receptor-type tyrosine-protein phosphatase delta
  • R-PTP-Delta
  • RPTP-Delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7475
Species: Hu, Rt
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
AF3430
Species: Hu
Applications: WB, ICC
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
MAB4608
Species: Hu, Mu, Rt
Applications: WB
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02332
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
21720002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for PTPRD Antibody (NBP2-49153) (0)

There are no publications for PTPRD Antibody (NBP2-49153).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPRD Antibody (NBP2-49153) (0)

There are no reviews for PTPRD Antibody (NBP2-49153). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PTPRD Antibody (NBP2-49153) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPRD Products

Bioinformatics Tool for PTPRD Antibody (NBP2-49153)

Discover related pathways, diseases and genes to PTPRD Antibody (NBP2-49153). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPRD Antibody (NBP2-49153)

Discover more about diseases related to PTPRD Antibody (NBP2-49153).
 

Pathways for PTPRD Antibody (NBP2-49153)

View related products by pathway.

PTMs for PTPRD Antibody (NBP2-49153)

Learn more about PTMs related to PTPRD Antibody (NBP2-49153).

Blogs on PTPRD

There are no specific blogs for PTPRD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPRD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRD
Entrez