PTPRD Antibody


Immunocytochemistry/ Immunofluorescence: PTPRD Antibody [NBP2-49153] - Immunofluorescent staining of human cell line RH-30 shows localization to vesicles.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PTPRD Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids:GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTPRD Recombinant Protein Antigen (NBP2-49153PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PTPRD Antibody

  • HPTPMGC119752
  • MGC119750
  • MGC119751
  • protein tyrosine phosphatase, receptor type, D
  • Protein-tyrosine phosphatase delta
  • PTP delta
  • PTPD
  • PTPdelta
  • PTP-delta
  • PTPDMGC119753
  • receptor type, delta polypeptide
  • receptor-type tyrosine-protein phosphatase delta
  • R-PTP-Delta
  • RPTP-Delta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PTPRD Antibody (NBP2-49153) (0)

There are no publications for PTPRD Antibody (NBP2-49153).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPRD Antibody (NBP2-49153) (0)

There are no reviews for PTPRD Antibody (NBP2-49153). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PTPRD Antibody (NBP2-49153) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PTPRD Products

Bioinformatics Tool for PTPRD Antibody (NBP2-49153)

Discover related pathways, diseases and genes to PTPRD Antibody (NBP2-49153). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPRD Antibody (NBP2-49153)

Discover more about diseases related to PTPRD Antibody (NBP2-49153).

Pathways for PTPRD Antibody (NBP2-49153)

View related products by pathway.

PTMs for PTPRD Antibody (NBP2-49153)

Learn more about PTMs related to PTPRD Antibody (NBP2-49153).

Blogs on PTPRD

There are no specific blogs for PTPRD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PTPRD Antibody and receive a gift card or discount.


Gene Symbol PTPRD