![Western Blot: PTOV1 Antibody [NBP1-79384] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize2/PTOV1-Antibody-Western-Blot-NBP1-79384-img0007.jpg "Western Blot: PTOV1 Antibody [NBP1-79384] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptide directed towards the N terminal of human PTOV1The immunogen for this antibody is PTOV1. Peptide sequence DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTOV1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against PTOV1 and was validated on Western blot. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
-Antibody-Western-Blot-NBP3-09392-img0001.jpg)
-Flow-Cytometry-NB600-1160-img0011.jpg)
-Immunocytochemistry-Immunofluorescence-NB600-1160-img0012.jpg)
-Western-Blot-NB600-1160-img0013.jpg)
-Western-Blot-NBP2-32840-img0006.jpg)
-Flow-Cytometry-NBP2-32840-img0007.jpg)
-Flow-Cytometry-NBP2-32840-img0008.jpg)
-Flow-Cytometry-NBP2-01223-img0001.jpg)
-Western-Blot-NBP2-01223-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-01223-img0003.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for PTOV1 Antibody (NBP1-79384)Discover more about diseases related to PTOV1 Antibody (NBP1-79384).
| Pathways for PTOV1 Antibody (NBP1-79384)View related products by pathway.
|
Research Areas for PTOV1 Antibody (NBP1-79384)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: PTOV1 Antibody [NBP1-79384] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes and processes of intersticial cells Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://images.novusbio.com/fullsize2/PTOV1-Antibody-Immunohistochemistry-NBP1-79384-img0006.jpg "Immunohistochemistry: PTOV1 Antibody [NBP1-79384] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes and processes of intersticial cells Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec")
![Western Blot: PTOV1 Antibody [NBP1-79384] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/PTOV1-Antibody-Western-Blot-NBP1-79384-img0002.jpg "Western Blot: PTOV1 Antibody [NBP1-79384] - Jurkat cell lysate, concentration 0.2-1 ug/ml.")
![Western Blot: PTOV1 Antibody [NBP1-79384] - Analysis of 721_B whole cell lysates, Antibody Dilution: 0.5 ug/ml.](http://images.novusbio.com/fullsize2/PTOV1-Antibody-Western-Blot-NBP1-79384-img0004.jpg "Western Blot: PTOV1 Antibody [NBP1-79384] - Analysis of 721_B whole cell lysates, Antibody Dilution: 0.5 ug/ml.")
![Western Blot: PTOV1 Antibody [NBP1-79384] - Jurkat Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.](http://images.novusbio.com/fullsize2/PTOV1-Antibody-Western-Blot-NBP1-79384-img0005.jpg "Western Blot: PTOV1 Antibody [NBP1-79384] - Jurkat Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images2/Androgen-R-NR3C4-[p-Ser213--p-Ser210]-Antibody-(156C135.2)-Western-Blot-NB100-56603-img0004.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")