PTOV1 Antibody

Images

 
Western Blot: PTOV1 Antibody [NBP1-79384] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PTOV1 Antibody [NBP1-79384] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes and processes of ...read more
Western Blot: PTOV1 Antibody [NBP1-79384] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PTOV1 Antibody [NBP1-79384] - Analysis of 721_B whole cell lysates, Antibody Dilution: 0.5 ug/ml.
Western Blot: PTOV1 Antibody [NBP1-79384] - Jurkat Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

PTOV1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the N terminal of human PTOV1The immunogen for this antibody is PTOV1. Peptide sequence DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTOV1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for PTOV1 Antibody

  • ACID2
  • Activator interaction domain-containing protein 2
  • DKFZp586I111
  • MGC71475
  • prostate tumor overexpressed 1
  • prostate tumor overexpressed gene 1
  • PTOV-1

Background

PTOV1 may activate transcription. Required for nuclear translocation of FLOT1. Promotes cell proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTOV1 Antibody (NBP1-79384) (0)

There are no publications for PTOV1 Antibody (NBP1-79384).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTOV1 Antibody (NBP1-79384) (0)

There are no reviews for PTOV1 Antibody (NBP1-79384). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTOV1 Antibody (NBP1-79384) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTOV1 Products

Research Areas for PTOV1 Antibody (NBP1-79384)

Find related products by research area.

Blogs on PTOV1

There are no specific blogs for PTOV1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTOV1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTOV1
Uniprot