USP16 Antibody

Images

 
Western Blot: USP16 Antibody [NBP1-86881] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver
Immunocytochemistry/ Immunofluorescence: USP16 Antibody [NBP1-86881] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: USP16 Antibody [NBP1-86881] - Staining of human pancreas shows strong positivity in islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKQASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP16 Protein (NBP1-86881PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP16 Antibody

  • Deubiquitinating enzyme 16
  • EC 3.1.2.15
  • EC 3.4.19.12
  • human ubiquitin processing protease, EC 3.1.2.1510ubiquitin specific protease 16
  • ubiquitin carboxyl-terminal hydrolase 16
  • ubiquitin specific peptidase 16
  • ubiquitin thioesterase 16
  • Ubiquitin thiolesterase 16
  • Ubiquitin-processing protease UBP-M
  • ubiquitin-specific processing protease 16
  • Ubiquitin-specific-processing protease 16
  • UBP-M

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IP
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02648
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
AF8408
Species: Hu
Applications: WB
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-79384
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-59826
Species: Hu
Applications: WB, Simple Western, IP
NBP2-07996
Species: Hu

Publications for USP16 Antibody (NBP1-86881) (0)

There are no publications for USP16 Antibody (NBP1-86881).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP16 Antibody (NBP1-86881) (0)

There are no reviews for USP16 Antibody (NBP1-86881). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP16 Antibody (NBP1-86881) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP16 Products

Bioinformatics Tool for USP16 Antibody (NBP1-86881)

Discover related pathways, diseases and genes to USP16 Antibody (NBP1-86881). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP16 Antibody (NBP1-86881)

Discover more about diseases related to USP16 Antibody (NBP1-86881).
 

Pathways for USP16 Antibody (NBP1-86881)

View related products by pathway.

PTMs for USP16 Antibody (NBP1-86881)

Learn more about PTMs related to USP16 Antibody (NBP1-86881).
 

Research Areas for USP16 Antibody (NBP1-86881)

Find related products by research area.

Blogs on USP16

There are no specific blogs for USP16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP16