PTHLH/PTHrP Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PTHLH/PTHrP Antibody - BSA Free (NBP2-94646) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 25-175 of human PTHLH (NP_945315.1). RSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PTHLH |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:100 - 1:500
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PTHLH/PTHrP Antibody - BSA Free
Background
PTHLH is encoded by this gene is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, in-frame and downstream of the initiator AUG codon, to give rise to nuclear forms of this hormone. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: IHC, WB
Species: Bv, Ca, Eq, Hu, Pm, Mu, Po, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Rt
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu
Applications: BA
Publications for PTHLH/PTHrP Antibody (NBP2-94646) (0)
There are no publications for PTHLH/PTHrP Antibody (NBP2-94646).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTHLH/PTHrP Antibody (NBP2-94646) (0)
There are no reviews for PTHLH/PTHrP Antibody (NBP2-94646).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTHLH/PTHrP Antibody (NBP2-94646) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTHLH/PTHrP Products
Research Areas for PTHLH/PTHrP Antibody (NBP2-94646)
Find related products by research area.
|
Blogs on PTHLH/PTHrP