PSAP Recombinant Protein Antigen

Images

 
There are currently no images for PSAP Protein (NBP1-83363PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PSAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSAP.

Source: E.coli

Amino Acid Sequence: TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83363.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PSAP Recombinant Protein Antigen

  • FLJ00245
  • GLBA
  • proactivator polypeptide
  • prosaposin
  • PSAP
  • SAP1
  • SAP1MGC110993
  • sphingolipid activator protein-1

Background

PSAP is a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D, which are similar to each other and are sphingolipid hydrolase activator proteins. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in PSAP gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
H00002629-M01
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-01264
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2558
Species: Hu, Mu
Applications: Simple Western, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87092
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
267-N3/CF
Species: Hu
Applications: BA
AF1085
Species: Mu
Applications: IHC, Neut, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-45889
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-47289
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF2934
Species: Mu
Applications: Block, IHC, Simple Western, WB
NBP1-83363PEP
Species: Hu
Applications: AC

Publications for PSAP Protein (NBP1-83363PEP) (0)

There are no publications for PSAP Protein (NBP1-83363PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSAP Protein (NBP1-83363PEP) (0)

There are no reviews for PSAP Protein (NBP1-83363PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PSAP Protein (NBP1-83363PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSAP Products

Bioinformatics Tool for PSAP Protein (NBP1-83363PEP)

Discover related pathways, diseases and genes to PSAP Protein (NBP1-83363PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSAP Protein (NBP1-83363PEP)

Discover more about diseases related to PSAP Protein (NBP1-83363PEP).
 

Pathways for PSAP Protein (NBP1-83363PEP)

View related products by pathway.

PTMs for PSAP Protein (NBP1-83363PEP)

Learn more about PTMs related to PSAP Protein (NBP1-83363PEP).
 

Research Areas for PSAP Protein (NBP1-83363PEP)

Find related products by research area.

Blogs on PSAP

There are no specific blogs for PSAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PSAP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSAP