PRRX1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PRRX1 Antibody [NBP2-68808] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRRX1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRRX1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
PRRX1 Recombinant Protein Antigen (NBP2-68808PEP)
Publications
Read Publication using
NBP2-68808 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PRRX1 Antibody

  • Homeobox protein PHOX1
  • paired mesoderm homeo box 1
  • paired mesoderm homeobox 1 isoform pmx-1b
  • paired mesoderm homeobox protein 1
  • paired related homeobox 1
  • Paired-related homeobox protein 1
  • PHOX1PRX-1
  • PMX1PRX1

Background

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051450-D01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
H00009588-M01
Species: Bv, Hu
Applications: DB, ELISA, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
H00006202-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
AF6610
Species: Hu, Mu
Applications: WB
423-F8
Species: Hu, Mu
Applications: BA
1845-SH/CF
Species: Hu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
210-TA
Species: Hu
Applications: BA
314-BP/CF
Species: Hu
Applications: BA, BA

Publications for PRRX1 Antibody (NBP2-68808)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Rat
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP2-68808 Applications Species
Ray T, Shah A, Bulla Ga, Ray Ps Gatekeeper transcription factors regulate switch between lineage preservation and cell plasticity bioRxiv Jan 1 2020 (ICC/IF, Rat) ICC/IF Rat

Reviews for PRRX1 Antibody (NBP2-68808) (0)

There are no reviews for PRRX1 Antibody (NBP2-68808). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRRX1 Antibody (NBP2-68808) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRRX1 Products

Bioinformatics Tool for PRRX1 Antibody (NBP2-68808)

Discover related pathways, diseases and genes to PRRX1 Antibody (NBP2-68808). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRRX1 Antibody (NBP2-68808)

Discover more about diseases related to PRRX1 Antibody (NBP2-68808).
 

Pathways for PRRX1 Antibody (NBP2-68808)

View related products by pathway.

PTMs for PRRX1 Antibody (NBP2-68808)

Learn more about PTMs related to PRRX1 Antibody (NBP2-68808).
 

Research Areas for PRRX1 Antibody (NBP2-68808)

Find related products by research area.

Blogs on PRRX1

There are no specific blogs for PRRX1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRRX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRX1