| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, ChIP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PRRX1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP2-68808 | Applications | Species |
|---|---|---|
| Herter S, Emperador M, Smyrilli K et al. High content-imaging drug synergy screening identifies specific senescence-related vulnerabilities of mesenchymal neuroblastomas. Cell death & disease 2025-08-26 [PMID: 40854877] | ||
| Ray T, Shah A, Bulla Ga, Ray Ps Gatekeeper transcription factors regulate switch between lineage preservation and cell plasticity bioRxiv 2020-01-01 (ICC/IF, Rat) | ICC/IF | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for PRRX1 Antibody (NBP2-68808)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PRRX1 |