Protocadherin alpha 4 Antibody

Images

 
Western Blot: PCDHA4 Antibody [NBP1-59257] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Protocadherin alpha 4 Antibody Summary

Immunogen
Synthetic peptides corresponding to PCDHA4(protocadherin alpha 4) The peptide sequence was selected from the C terminal of PCDHA4. Peptide sequence SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL.
Clonality
Polyclonal
Host
Rabbit
Gene
PCDHA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCDHA4 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Protocadherin alpha 4 Antibody

  • CNR1
  • CNRN1
  • CRNR1
  • KIAA0345-like 10
  • MGC138307
  • MGC142169
  • ortholog of mouse CNR1
  • PCDHA4
  • PCDH-ALPHA4
  • PCDH-alpha-4
  • Protocadherin alpha 4
  • protocadherin alpha-4

Background

The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00001269-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00056142-T01
Species: Hu
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
AF1268
Species: Hu
Applications: WB, Simple Western, IP, ICC
NLS1405
Species: Hu, Bt, Bv, Ca, Eq, Rb
Applications: IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-78989
Species: Mu, Rt
Applications: WB (-), IHC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB8629
Species: Rt
Applications: IHC
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Protocadherin alpha 4 Antibody (NBP1-59257) (0)

There are no publications for Protocadherin alpha 4 Antibody (NBP1-59257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin alpha 4 Antibody (NBP1-59257) (0)

There are no reviews for Protocadherin alpha 4 Antibody (NBP1-59257). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin alpha 4 Antibody (NBP1-59257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin alpha 4 Antibody Products

Related Products by Gene

Bioinformatics Tool for Protocadherin alpha 4 Antibody (NBP1-59257)

Discover related pathways, diseases and genes to Protocadherin alpha 4 Antibody (NBP1-59257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin alpha 4 Antibody (NBP1-59257)

Discover more about diseases related to Protocadherin alpha 4 Antibody (NBP1-59257).
 

Pathways for Protocadherin alpha 4 Antibody (NBP1-59257)

View related products by pathway.

PTMs for Protocadherin alpha 4 Antibody (NBP1-59257)

Learn more about PTMs related to Protocadherin alpha 4 Antibody (NBP1-59257).

Blogs on Protocadherin alpha 4

There are no specific blogs for Protocadherin alpha 4, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PCDHA4
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59257 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought