Protocadherin alpha 4 Antibody

Images

 
Western Blot: PCDHA4 Antibody [NBP1-59257] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protocadherin alpha 4 Antibody Summary

Immunogen
Synthetic peptides corresponding to PCDHA4(protocadherin alpha 4) The peptide sequence was selected from the C terminal of PCDHA4. Peptide sequence SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL.
Clonality
Polyclonal
Host
Rabbit
Gene
PCDHA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCDHA4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Protocadherin alpha 4 Antibody

  • CNR1
  • CNRN1
  • CRNR1
  • KIAA0345-like 10
  • MGC138307
  • MGC142169
  • ortholog of mouse CNR1
  • PCDHA4
  • PCDH-ALPHA4
  • PCDH-alpha-4
  • Protocadherin alpha 4
  • protocadherin alpha-4

Background

The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00001269-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-57234
Species: Hu
Applications: ICC/IF
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NB600-602
Species: Hu, Mu
Applications: WB, ELISA, Flow, IP
NBP2-32975
Species: Hu, Rt, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NLS1405
Species: Hu, Bt, Bv, Ca, Eq, Rb
Applications: IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-78989
Species: Mu, Rt
Applications: WB (-), IHC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1618
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59257
Species: Hu
Applications: WB

Publications for Protocadherin alpha 4 Antibody (NBP1-59257) (0)

There are no publications for Protocadherin alpha 4 Antibody (NBP1-59257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin alpha 4 Antibody (NBP1-59257) (0)

There are no reviews for Protocadherin alpha 4 Antibody (NBP1-59257). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin alpha 4 Antibody (NBP1-59257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin alpha 4 Antibody Products

Related Products by Gene

Bioinformatics Tool for Protocadherin alpha 4 Antibody (NBP1-59257)

Discover related pathways, diseases and genes to Protocadherin alpha 4 Antibody (NBP1-59257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin alpha 4 Antibody (NBP1-59257)

Discover more about diseases related to Protocadherin alpha 4 Antibody (NBP1-59257).
 

Pathways for Protocadherin alpha 4 Antibody (NBP1-59257)

View related products by pathway.

PTMs for Protocadherin alpha 4 Antibody (NBP1-59257)

Learn more about PTMs related to Protocadherin alpha 4 Antibody (NBP1-59257).

Blogs on Protocadherin alpha 4

There are no specific blogs for Protocadherin alpha 4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin alpha 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHA4
Entrez

Customers Who Bought This Also Bought