Protein Phosphatase 1C gamma Antibody

Images

 
Western Blot: Protein Phosphatase 1C gamma Antibody [H00005501-B02P] - Analysis of PPP1CC expression in transfected 293T cell line by PPP1CC polyclonal antibody. Lane 1: PPP1CC transfected lysate(37.00 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Protein Phosphatase 1C gamma Antibody [H00005501-B02P] - Analysis of purified antibody to PPP1CC on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Protein Phosphatase 1C gamma Antibody Summary

Immunogen
PPP1CC (NP_002701.1, 1 a.a. - 323 a.a.) full-length human protein. MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PPP1CC
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protein Phosphatase 1C gamma Antibody

  • EC 3.1.3.16
  • PP-1G
  • PP1gamma
  • PPP1G
  • protein phosphatase 1, catalytic subunit, gamma isoform
  • protein phosphatase 1, catalytic subunit, gamma isozyme
  • Protein phosphatase 1C catalytic subunit
  • serine/threonine phosphatase 1 gamma
  • serine/threonine-protein phosphatase PP1-gamma catalytic subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB3000
Species: Hu, Mu, Rt
Applications: WB
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47924
Species: Hu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NB110-38867
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6978
Species: Hu, Mu, Rt
Applications: WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-59934
Species: Hu
Applications: WB
H00005501-B02P
Species: Hu
Applications: WB, ICC/IF

Publications for Protein Phosphatase 1C gamma Antibody (H00005501-B02P) (0)

There are no publications for Protein Phosphatase 1C gamma Antibody (H00005501-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Phosphatase 1C gamma Antibody (H00005501-B02P) (0)

There are no reviews for Protein Phosphatase 1C gamma Antibody (H00005501-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Protein Phosphatase 1C gamma Antibody (H00005501-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein Phosphatase 1C gamma Products

Bioinformatics Tool for Protein Phosphatase 1C gamma Antibody (H00005501-B02P)

Discover related pathways, diseases and genes to Protein Phosphatase 1C gamma Antibody (H00005501-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein Phosphatase 1C gamma Antibody (H00005501-B02P)

Discover more about diseases related to Protein Phosphatase 1C gamma Antibody (H00005501-B02P).
 

Pathways for Protein Phosphatase 1C gamma Antibody (H00005501-B02P)

View related products by pathway.

PTMs for Protein Phosphatase 1C gamma Antibody (H00005501-B02P)

Learn more about PTMs related to Protein Phosphatase 1C gamma Antibody (H00005501-B02P).
 

Research Areas for Protein Phosphatase 1C gamma Antibody (H00005501-B02P)

Find related products by research area.

Blogs on Protein Phosphatase 1C gamma

There are no specific blogs for Protein Phosphatase 1C gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein Phosphatase 1C gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1CC
Uniprot