PP2C gamma/PPM1G Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining in human testis and pancreas tissues using anti-PPM1G antibody. Corresponding PPM1G RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-PPM1G antibody NBP1-87246 (A) shows ...read more
Genetic Strategies: Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87246] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PPM1G antibody. Remaining ...read more
Independent Antibodies: Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87246] - Analysis using Anti-PPM1G antibody NBP1-87246 (A) shows similar pattern to independent antibody NBP1-87245 (B).
Immunocytochemistry/ Immunofluorescence: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human lymph node.
Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87246] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PP2C gamma/PPM1G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPM1G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PP2C gamma/PPM1G Protein (NBP1-87246PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PP2C gamma/PPM1G Antibody

  • EC 3.1.3.16
  • MGC1675
  • MGC2870
  • PP2C gamma
  • PP2C, gamma
  • PP2CG
  • PP2CGAMMA
  • PP2C-gamma
  • PPM1C
  • PPM1G
  • PPP2CG
  • Protein phosphatase 1C
  • protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform
  • protein phosphatase 1G
  • protein phosphatase 2, catalytic subunit, gamma isoform
  • protein phosphatase 2C gamma isoform
  • Protein phosphatase 2C isoform gamma
  • Protein phosphatase magnesium-dependent 1 gamma
  • protein phosphatase, Mg2+/Mn2+ dependent, 1G

Background

PPM1G is encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32858
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-20521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-89945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-41403
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-93867
Species: Hu, Mu, Rt
Applications: WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB100-513
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NLS3890
Species: Bv, Hu, Pm, Pm
Applications: IHC, IHC-P
NBP2-52454
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB

Publications for PP2C gamma/PPM1G Antibody (NBP1-87246) (0)

There are no publications for PP2C gamma/PPM1G Antibody (NBP1-87246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C gamma/PPM1G Antibody (NBP1-87246) (0)

There are no reviews for PP2C gamma/PPM1G Antibody (NBP1-87246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PP2C gamma/PPM1G Antibody (NBP1-87246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PP2C gamma/PPM1G Products

Bioinformatics Tool for PP2C gamma/PPM1G Antibody (NBP1-87246)

Discover related pathways, diseases and genes to PP2C gamma/PPM1G Antibody (NBP1-87246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP2C gamma/PPM1G Antibody (NBP1-87246)

Discover more about diseases related to PP2C gamma/PPM1G Antibody (NBP1-87246).
 

Pathways for PP2C gamma/PPM1G Antibody (NBP1-87246)

View related products by pathway.

PTMs for PP2C gamma/PPM1G Antibody (NBP1-87246)

Learn more about PTMs related to PP2C gamma/PPM1G Antibody (NBP1-87246).
 

Research Areas for PP2C gamma/PPM1G Antibody (NBP1-87246)

Find related products by research area.

Blogs on PP2C gamma/PPM1G

There are no specific blogs for PP2C gamma/PPM1G, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PP2C gamma/PPM1G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1G