PPP1R3A Antibody

Images

 
Immunohistochemistry-Paraffin: PPP1R3A Antibody [NBP3-17131] - Staining of human smooth muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PPP1R3A Antibody [NBP3-17131] - Analysis in human skeletal muscle and smooth muscle tissues using Anti-PPP1R3A antibody. Corresponding PPP1R3A RNA-seq data ...read more
Immunohistochemistry-Paraffin: PPP1R3A Antibody [NBP3-17131] - Staining of human skeletal muscle shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PPP1R3A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: EETTSNMGEIKPSLGDTSSDELVQLHTGSKEVLDDNANPAHGNGTMQIPCPSSDQLMAGNLNKKHEGGAKKIEVKDLGCLRRDFHSDTSACLKESTEEG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R3A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PPP1R3A Antibody

  • glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle
  • GM
  • PP1G
  • PPP1R3
  • protein phosphatase 1 glycogen- associated regulatory subunit
  • Protein phosphatase 1 glycogen-associated regulatory subunit
  • protein phosphatase 1 regulatory subunit 3A
  • protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen andsarcoplasmic reticulum binding subunit, skeletal muscle)
  • protein phosphatase 1, regulatory (inhibitor) subunit 3A
  • Protein phosphatase type-1 glycogen targeting subunit
  • RG1
  • serine /threonine specific protein phosphatase
  • type-1 protein phosphatase skeletal muscle glycogen targeting subunit

Background

The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37-kD catalytic subunit and a 124-kD targeting and regulatory subunit. This gene encodes the regulatory subunit which binds to muscle glycogen with high affinity, thereby enhancing dephosphorylation of glycogen-bound substrates for PP1 such as glycogen synthase and glycogen phosphorylase kinase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7954-GM/CF
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
210-TA
Species: Hu
Applications: BA
203-IL/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
D6050
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MEP00B
Species: Mu
Applications: ELISA
255-SC/CF
Species: Hu
Applications: BA
MCS00
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
MCS00
Species: Mu
Applications: ELISA
H00079660-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
201-LB/CF
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
285-IF
Species: Hu
Applications: BA
233-FB/CF
Species: Hu
Applications: BA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB110-60930
Species: Hu, Mu
Applications: WB
NBP3-17131
Species: Hu
Applications: IHC, IHC-P

Publications for PPP1R3A Antibody (NBP3-17131) (0)

There are no publications for PPP1R3A Antibody (NBP3-17131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R3A Antibody (NBP3-17131) (0)

There are no reviews for PPP1R3A Antibody (NBP3-17131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPP1R3A Antibody (NBP3-17131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP1R3A Products

Bioinformatics Tool for PPP1R3A Antibody (NBP3-17131)

Discover related pathways, diseases and genes to PPP1R3A Antibody (NBP3-17131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP1R3A Antibody (NBP3-17131)

Discover more about diseases related to PPP1R3A Antibody (NBP3-17131).
 

Pathways for PPP1R3A Antibody (NBP3-17131)

View related products by pathway.

PTMs for PPP1R3A Antibody (NBP3-17131)

Learn more about PTMs related to PPP1R3A Antibody (NBP3-17131).

Blogs on PPP1R3A

There are no specific blogs for PPP1R3A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP1R3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R3A