Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

Images

 
Western Blot: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Lane 1: Marker [kDa] 250,130,100,70,55,35,25,15,10. Lane 2: Human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Simple Western: Protein Kinase A regulatory subunit I alpha Antibody [NBP2-33585] - Lane view shows a specific band for Protein Kinase A regulatory subunit I alpha using 200 ug/mL of Sk-Mel-28 cell lysate and 4 ug/mL ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Protein Kinase A regulatory subunit I alpha Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Protein Kinase A regulatory subunit I alpha Antibody - BSA Free (NBP2-33585) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKAR1A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in Sk-Mel-28 and h. Liver lysates, separated by Size, antibody dilution of 1:25, apparent MW was 55 kDa
Control Peptide
Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen (NBP2-33585PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Protein Kinase A regulatory subunit I alpha Antibody - BSA Free

  • cAMP-dependent protein kinase regulatory subunit RIalpha
  • cAMP-dependent protein kinase type I-alpha regulatory chain
  • cAMP-dependent protein kinase type I-alpha regulatory subunit
  • CAR
  • CNC
  • CNC1
  • MGC17251
  • PKA R1 alpha
  • PKA1
  • PKR1
  • PPNAD1
  • PRKAR1
  • PRKAR1A
  • Protein Kinase A regulatory subunit I alpha
  • protein kinase A type 1a regulatory subunit
  • protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specificextinguisher 1)
  • Tissue-specific extinguisher 1
  • TSE1
  • TSE1DKFZp779L0468

Background

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Three alternatively spliced transcript variants encoding the same protein have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
AF7356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF2654
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-01800
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NBP1-83299
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00001556-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-38258
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB2005
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for Protein Kinase A regulatory subunit I alpha Antibody (NBP2-33585) (0)

There are no publications for Protein Kinase A regulatory subunit I alpha Antibody (NBP2-33585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Kinase A regulatory subunit I alpha Antibody (NBP2-33585) (0)

There are no reviews for Protein Kinase A regulatory subunit I alpha Antibody (NBP2-33585). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protein Kinase A regulatory subunit I alpha Antibody (NBP2-33585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein Kinase A regulatory subunit I alpha Products

Research Areas for Protein Kinase A regulatory subunit I alpha Antibody (NBP2-33585)

Find related products by research area.

Blogs on Protein Kinase A regulatory subunit I alpha

There are no specific blogs for Protein Kinase A regulatory subunit I alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein Kinase A regulatory subunit I alpha Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAR1A
Uniprot