Prokineticin R2/PROKR2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Prokineticin R2/PROKR2 Antibody [NBP1-92290] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Prokineticin R2/PROKR2 Antibody [NBP1-92290] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Prokineticin R2/PROKR2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PROKR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Prokineticin R2/PROKR2 Protein (NBP1-92290PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Prokineticin R2/PROKR2 Antibody - BSA Free

• dJ680N4.3
• G protein-coupled receptor 73-like 1
• GPR73bG-protein coupled receptor 73-like 1
• GPR73L1
• GPR73L1Kallmann syndrome 3 (autosomal dominant)
• GPRg2
• GPRg2KAL3
• KAL3
• PKR2
• PKR2PK-R2
• Prokineticin R2
• prokineticin receptor 2
• ProkineticinR2
• PROKR2

Background

Corticotropin Releasing Factor Receptor 2 (CRHR2) expression has been reported in various regions of the brain, as well as in placenta, umbilical vein, heart, epididymis, gastrointestinal tract, adrenal, and skeletal muscle. It shows high-affinity CRF binding and also binds to urocortin I, II and III. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. CRCH2 alpha is the dominant isoform and is expressed widely. CRCH2 beta is expressed in the hippocampus, septum, amygdala, heart, and skeletal muscle. CRHR2 gamma is brain-specific. ESTs have been isolated from brain libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Prokineticin R2/PROKR2 Antibody (NBP1-92290)(1)

Publication using NBP1-92290

• Noda K, Dufner B, Ito H et al. Differential inflammation-mediated function of prokineticin 2 in the synovial fibroblasts of patients with rheumatoid arthritis compared with osteoarthritis Scientific reports 2021-09-15 [PMID: 34526577] (IHC-P, Human)

Bioinformatics

• Gene Symbol: PROKR2