KiSS1R/GPR54 Antibody - BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KiSS1R/GPR54 (NP_115940.2).
Sequence: SYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KISS1R |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 - 1:100
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
43 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KiSS1R/GPR54 Antibody - BSA Free
Background
GPR54 is a Metastin Receptor. Metastin, also known as KiSS-1, is a metastasis suppressor gene. Mutations in GPR54 have been shown to cause autosomal recessive idiopathic hypogonadotropic hypogonadism in humans and mice, suggesting that GPR54 is a key regulator for the onset of puberty (Seminara et al. 2003). GPR54 has been reported in various human brain regions, placenta, pancreas, and spinal cord, and at lower levels in spleen, peripheral blood leukocytes, testis, lymph node, thymus, small intestine, stomach, lung, and kidney. The receptor is also abundant in tumor tissues. In rat, GPR54 is expressed in liver, intestine, and in the pons, midbrain, thalamus, hypothalamus, hippocampus, amygdala, cortex (including frontal), and striatum. ESTs have been isolated from normal placenta and kidney cancer libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Gp, Hu(-), Mu, Rt, Sh
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, WB (-)
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Publications for KiSS1R/GPR54 Antibody (NBP3-38024) (0)
There are no publications for KiSS1R/GPR54 Antibody (NBP3-38024).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KiSS1R/GPR54 Antibody (NBP3-38024) (0)
There are no reviews for KiSS1R/GPR54 Antibody (NBP3-38024).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KiSS1R/GPR54 Antibody (NBP3-38024) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KiSS1R/GPR54 Products
Research Areas for KiSS1R/GPR54 Antibody (NBP3-38024)
Find related products by research area.
|
Blogs on KiSS1R/GPR54