Prohibitin Antibody (0V2R10)

Western Blot: Prohibitin Antibody (0V2R10) [NBP3-15756] - Western blot analysis of extracts of various cell lines, using Prohibitin antibody (NBP3-15756) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunohistochemistry: Prohibitin Antibody (0V2R10) [NBP3-15756] - Immunohistochemistry analysis of Prohibitin in paraffin-embedded mouse kidney tissue using Prohibitin Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Prohibitin Antibody (0V2R10) [NBP3-15756] - Immunohistochemistry analysis of Prohibitin in paraffin-embedded human colon carcinoma tissue using Prohibitin Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Prohibitin Antibody (0V2R10) [NBP3-15756] - Immunohistochemistry analysis of Prohibitin in paraffin-embedded human thyroid cancer tissue using Prohibitin Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Prohibitin Antibody (0V2R10) [NBP3-15756] - Immunohistochemistry analysis of Prohibitin in paraffin-embedded rat kidney tissue using Prohibitin Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Prohibitin Antibody (0V2R10) [NBP3-15756] - Immunohistochemistry analysis of Prohibitin in paraffin-embedded human liver tissue using Prohibitin Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Prohibitin Antibody (0V2R10) [NBP3-15756] - Immunohistochemistry analysis of Prohibitin in paraffin-embedded rat liver tissue using Prohibitin Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 0V2R10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Prohibitin Antibody (0V2R10) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin (P35232). ASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PHB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Prohibitin Antibody (0V2R10)

• PHB
• PHB1
• Prohibitin

Background

Prohibitin is an evolutionarily conserved protein located in the inner membrane of mitochondria. Prohibitin shows antiproliferative activity and has been proposed to play a role in normal cell cycle regulation, replicative senescence, cellular immortalization and tumor suppression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHB1