PRKCDBP Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 75-160 of human PRKCDBP (NP_659477.2).
Sequence: SNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CAVIN3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for PRKCDBP Antibody - BSA Free
Background
PRKCDBP, also known as Protein kinase C delta-binding protein, is 261 amino acids in length and approximately 27kDa. PRKCDBP is highly expressed in epithelial cells, and is down regulated in lung cancer cell lines and breast cancer cell lines, thus suggesting the possibility of tumor suppressor function. PRKCDBP binds and is phosphorylated by protein kinase C, delta. Current research surrounding PRKCDBP shows a possible connection with ovarian cancer, gastric cancer and lung cancer. PRKCDBP has also been shown to interact with Caveolin 1, Caveolin 3, cMyc, SDPR, and EPS15L1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: BA
Species: Rt
Applications: WB, ELISA
Publications for PRKCDBP Antibody (NBP3-35738) (0)
There are no publications for PRKCDBP Antibody (NBP3-35738).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PRKCDBP Antibody (NBP3-35738) (0)
There are no reviews for PRKCDBP Antibody (NBP3-35738).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PRKCDBP Antibody (NBP3-35738) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PRKCDBP Products
Research Areas for PRKCDBP Antibody (NBP3-35738)
Find related products by research area.
|
Blogs on PRKCDBP