Presenilin-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Presenilin-1 Antibody [NBP2-57002] - Staining of human cell line MCF7 shows localization to the Golgi apparatus & cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Presenilin-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ
Specificity
Specificity of human Presenilin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSEN1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Presenilin-1 Recombinant Protein Antigen (NBP2-57002PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Presenilin-1 Antibody

  • AD3EC 3.4.23.-
  • Alzheimer disease 3
  • EC 3.4.23
  • FAD
  • presenilin 1
  • Presenilin1
  • Presenilin-1
  • Protein S182
  • PS-1
  • PS1presenilin-1
  • PSEN1
  • PSNL1
  • S182

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-75632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77269
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-92892
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57002
Species: Hu
Applications: ICC/IF

Publications for Presenilin-1 Antibody (NBP2-57002) (0)

There are no publications for Presenilin-1 Antibody (NBP2-57002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Presenilin-1 Antibody (NBP2-57002) (0)

There are no reviews for Presenilin-1 Antibody (NBP2-57002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Presenilin-1 Antibody (NBP2-57002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Presenilin-1 Products

Bioinformatics Tool for Presenilin-1 Antibody (NBP2-57002)

Discover related pathways, diseases and genes to Presenilin-1 Antibody (NBP2-57002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Presenilin-1 Antibody (NBP2-57002)

Discover more about diseases related to Presenilin-1 Antibody (NBP2-57002).
 

Pathways for Presenilin-1 Antibody (NBP2-57002)

View related products by pathway.

PTMs for Presenilin-1 Antibody (NBP2-57002)

Learn more about PTMs related to Presenilin-1 Antibody (NBP2-57002).
 

Research Areas for Presenilin-1 Antibody (NBP2-57002)

Find related products by research area.

Blogs on Presenilin-1.

Mechanisms of Neurodegeneration: Protein aggregation and failure of autophagy
By Michalina Hanzel, PhDIn a series of three blog posts I will briefly explore the major cellular mechanisms responsible for many neurodegenerative disorders. The first, and perhaps the most apparent, is the accumulat...  Read full blog post.

Immunity’s flipside: Microglia promote Alzheimer’s pathology during inflammation
By Jamshed Arslan Pharm.D. Microglia are brain's macrophages. In Alzheimer's disease (AD), microglia clear up protein aggregates called amyloid beta plaques. The connection between immune activation and AD is unclea...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Presenilin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSEN1