Pregnancy Zone Protein Antibody


Immunohistochemistry: Pregnancy Zone Protein Antibody [NBP1-85490] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Pregnancy Zone Protein Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:QFSINTTSISVNKLFVRVFTVHPNLCFHYSWVAEDHQGAQHTANRVFSLSGSYIHLEPVAGTLPCGHTETITAHYT
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pregnancy Zone Protein Protein (NBP1-85490PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Pregnancy Zone Protein Antibody

  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6
  • CPAMD6
  • Pregnancy Zone Protein
  • pregnancy-zone protein
  • PZP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Ba
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IP, ICC
Species: Hu
Applications: IHC, IHC-P

Publications for Pregnancy Zone Protein Antibody (NBP1-85490) (0)

There are no publications for Pregnancy Zone Protein Antibody (NBP1-85490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pregnancy Zone Protein Antibody (NBP1-85490) (0)

There are no reviews for Pregnancy Zone Protein Antibody (NBP1-85490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pregnancy Zone Protein Antibody (NBP1-85490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Pregnancy Zone Protein Products

Bioinformatics Tool for Pregnancy Zone Protein Antibody (NBP1-85490)

Discover related pathways, diseases and genes to Pregnancy Zone Protein Antibody (NBP1-85490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pregnancy Zone Protein Antibody (NBP1-85490)

Discover more about diseases related to Pregnancy Zone Protein Antibody (NBP1-85490).

Pathways for Pregnancy Zone Protein Antibody (NBP1-85490)

View related products by pathway.

PTMs for Pregnancy Zone Protein Antibody (NBP1-85490)

Learn more about PTMs related to Pregnancy Zone Protein Antibody (NBP1-85490).

Blogs on Pregnancy Zone Protein

There are no specific blogs for Pregnancy Zone Protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Pregnancy Zone Protein Antibody and receive a gift card or discount.


Gene Symbol PZP