Pregnancy Zone Protein Antibody - BSA Free

Immunohistochemistry-Paraffin: Pregnancy Zone Protein Antibody [NBP1-85490] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Pregnancy Zone Protein Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Pregnancy Zone Protein Antibody - BSA Free (NBP1-85490) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QFSINTTSISVNKLFVRVFTVHPNLCFHYSWVAEDHQGAQHTANRVFSLSGSYIHLEPVAGTLPCGHTETITAHYT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PZP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Pregnancy Zone Protein Protein (NBP1-85490PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Pregnancy Zone Protein Antibody - BSA Free

• C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6
• CPAMD6
• Pregnancy Zone Protein
• pregnancy-zone protein
• PZP

Background

PZP is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PZP