Pref-1/DLK1/FA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Analysis in human adrenal gland and rectum tissues using NBP2-32358 antibody. Corresponding DLK1 RNA-seq data are presented for the same tissues

Immunocytochemistry/Immunofluorescence: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human cell line SH-SY5Y shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human fallopian tube shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human adrenal gland shows moderate membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human cerebral cortex shows no psotivity in neuronal cells as expected.

Immunohistochemistry-Paraffin: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human rectum shows no positivity in glandular cells as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Pref-1/DLK1/FA1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DLK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  Pref-1/DLK1/FA1 Protein (NBP2-32358PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pref-1/DLK1/FA1 Antibody - BSA Free

• delta-like 1 homolog (Drosophila)
• DLK
• DLK1
• DLK-1
• FA1
• FA1fetal antigen 1
• pG2
• pG2delta-like homolog (Drosophila)
• preadipocyte factor 1
• Pref1
• Pref-1
• protein delta homolog 1
• secredeltin
• ZOG

Background

DLK1 may have a role in neuroendocrine differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLK1