Pref-1/DLK1/FA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human cell line SH-SY5Y shows localization to the Golgi apparatus.
Immunohistochemistry: Pref-1/DLK1/FA1 Antibody [NBP2-32358] - Staining of human placenta shows positivity in endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pref-1/DLK1/FA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pref-1/DLK1/FA1 Protein (NBP2-32358PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pref-1/DLK1/FA1 Antibody

  • delta-like 1 homolog (Drosophila)
  • DLK
  • DLK1
  • DLK-1
  • FA1
  • FA1fetal antigen 1
  • pG2
  • pG2delta-like homolog (Drosophila)
  • preadipocyte factor 1
  • Pref1
  • Pref-1
  • protein delta homolog 1
  • secredeltin
  • ZOG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-46063
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-81272
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO

Publications for Pref-1/DLK1/FA1 Antibody (NBP2-32358) (0)

There are no publications for Pref-1/DLK1/FA1 Antibody (NBP2-32358).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pref-1/DLK1/FA1 Antibody (NBP2-32358) (0)

There are no reviews for Pref-1/DLK1/FA1 Antibody (NBP2-32358). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Pref-1/DLK1/FA1 Antibody (NBP2-32358) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pref-1/DLK1/FA1 Products

Bioinformatics Tool for Pref-1/DLK1/FA1 Antibody (NBP2-32358)

Discover related pathways, diseases and genes to Pref-1/DLK1/FA1 Antibody (NBP2-32358). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pref-1/DLK1/FA1 Antibody (NBP2-32358)

Discover more about diseases related to Pref-1/DLK1/FA1 Antibody (NBP2-32358).
 

Pathways for Pref-1/DLK1/FA1 Antibody (NBP2-32358)

View related products by pathway.

PTMs for Pref-1/DLK1/FA1 Antibody (NBP2-32358)

Learn more about PTMs related to Pref-1/DLK1/FA1 Antibody (NBP2-32358).

Blogs on Pref-1/DLK1/FA1

There are no specific blogs for Pref-1/DLK1/FA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pref-1/DLK1/FA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLK1
Entrez