PR48 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PPP2R3B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PR48 Antibody - BSA Free
Background
PP2A is a major serine/threonine phosphatase that is implicated in the negative control of cell cycle progression. It is a trimeric holoenzyme that is comprised of a catalytic, structural, and regulatory subunit. PPP2R3B is a regulatory subunit of PP2A. The regulatory subunits of PP2A are grouped into 3 families: B/PR55, B'/PR61, and B''/PR72. PPP2R3B encodes a 48 kDa B'' regulatory subunit. PPP2R3B and PP2A, in association with Cdc6, are implicated in cell cycle control via phosphatase activity targeted at DNA replication machinery.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: AdBlk, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ICC/IF
Publications for PR48 Antibody (NBP3-17915) (0)
There are no publications for PR48 Antibody (NBP3-17915).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PR48 Antibody (NBP3-17915) (0)
There are no reviews for PR48 Antibody (NBP3-17915).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PR48 Antibody (NBP3-17915) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PR48 Products
Research Areas for PR48 Antibody (NBP3-17915)
Find related products by research area.
|
Blogs on PR48