PPP2R5B Antibody - BSA Free

Western Blot: PPP2R5B Antibody [NBP1-88958] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4.

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human liver shows no positivity in hepatocytes as expected.

Western Blot: PPP2R5B Antibody [NBP1-88958] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human hippocampus shows moderate nuclear positivity in neurons.

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human cerebellum shows moderate to strong nuclear positivity in Purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPP2R5B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R5B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PPP2R5B Protein (NBP1-88958PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPP2R5B Antibody - BSA Free

• B56B
• FLJ35411
• PP2A B subunit isoform B56-beta
• PP2A B subunit isoform B'-beta
• PP2A B subunit isoform PR61-beta
• PP2A B subunit isoform R5-beta
• PR61B
• protein phosphatase 2, regulatory subunit B (B56), beta isoform
• protein phosphatase 2, regulatory subunit B', beta isoform
• protein phosphatase 2, regulatory subunit B', beta
• serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, betaisoform
• serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B56 subfamily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R5B