PPP2R5B Antibody

Images

 
Western Blot: PPP2R5B Antibody [NBP1-88958] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PPP2R5B Antibody [NBP1-88958] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Western Blot: PPP2R5B Antibody [NBP1-88958] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-443

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP2R5B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R5B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPP2R5B Protein (NBP1-88958PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP2R5B Antibody

  • B56B
  • FLJ35411
  • PP2A B subunit isoform B56-beta
  • PP2A B subunit isoform B'-beta
  • PP2A B subunit isoform PR61-beta
  • PP2A B subunit isoform R5-beta
  • PR61B
  • protein phosphatase 2, regulatory subunit B (B56), beta isoform
  • protein phosphatase 2, regulatory subunit B', beta isoform
  • protein phosphatase 2, regulatory subunit B', beta
  • serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, betaisoform
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16689
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87233
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBL1-14694
Species: Hu
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5665
Species: Mu, Rt
Applications: WB, IHC
NBP1-02434
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC

Publications for PPP2R5B Antibody (NBP1-88958) (0)

There are no publications for PPP2R5B Antibody (NBP1-88958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5B Antibody (NBP1-88958) (0)

There are no reviews for PPP2R5B Antibody (NBP1-88958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R5B Antibody (NBP1-88958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R5B Products

Bioinformatics Tool for PPP2R5B Antibody (NBP1-88958)

Discover related pathways, diseases and genes to PPP2R5B Antibody (NBP1-88958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R5B Antibody (NBP1-88958)

Discover more about diseases related to PPP2R5B Antibody (NBP1-88958).
 

Pathways for PPP2R5B Antibody (NBP1-88958)

View related products by pathway.

PTMs for PPP2R5B Antibody (NBP1-88958)

Learn more about PTMs related to PPP2R5B Antibody (NBP1-88958).
 

Research Areas for PPP2R5B Antibody (NBP1-88958)

Find related products by research area.

Blogs on PPP2R5B

There are no specific blogs for PPP2R5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R5B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5B