PPP2R3A Antibody

Images

 
Western Blot: PPP2R3A Antibody [NBP1-87233] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PPP2R3A Antibody [NBP1-87233] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP2R3A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPP2R3A Protein (NBP1-87233PEP)
Publications
Read Publication using NBP1-87233.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23204520)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP2R3A Antibody

  • PP2A subunit B isoform R3 isoform
  • PP2A subunit B isoforms B72/B130
  • PP2A subunit B isoforms B'-PR72/PR130
  • protein phosphatase 2 (formerly 2A), regulatory subunit B' (PR 72), alphaisoform and (PR 130), beta isoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B', alpha
  • protein phosphatase 2, regulatory subunit B', alpha
  • serine/threonine-protein phosphatase 2A regulatory subunit B' subunit alpha
  • subunit B, R3 isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00028227-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-33534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-14694
Species: Hu
NBP1-02434
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for PPP2R3A Antibody (NBP1-87233)(1)

Reviews for PPP2R3A Antibody (NBP1-87233) (0)

There are no reviews for PPP2R3A Antibody (NBP1-87233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R3A Antibody (NBP1-87233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R3A Products

Bioinformatics Tool for PPP2R3A Antibody (NBP1-87233)

Discover related pathways, diseases and genes to PPP2R3A Antibody (NBP1-87233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R3A Antibody (NBP1-87233)

Discover more about diseases related to PPP2R3A Antibody (NBP1-87233).
 

Pathways for PPP2R3A Antibody (NBP1-87233)

View related products by pathway.

PTMs for PPP2R3A Antibody (NBP1-87233)

Learn more about PTMs related to PPP2R3A Antibody (NBP1-87233).

Blogs on PPP2R3A

There are no specific blogs for PPP2R3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R3A