PPP2R5C Antibody

Images

 
Western Blot: PPP2R5C Antibody [NBP1-88961] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PPP2R5C Antibody [NBP1-88961] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP2R5C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQKDPKKDRPLARRKSELPQDPHTKKALEAHC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R5C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPP2R5C Protein (NBP1-88961PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP2R5C Antibody

  • B' alpha regulatory subunit
  • B56G
  • KIAA0044
  • MGC23064
  • PP2A B subunit isoform B56-gamma
  • PP2A B subunit isoform B'-gamma
  • PP2A B subunit isoform PR61-gamma
  • PP2A B subunit isoform R5-gamma
  • PR61G
  • protein phosphatase 2, regulatory subunit B (B56), gamma isoform
  • protein phosphatase 2, regulatory subunit B', gamma isoform
  • protein phosphatase 2, regulatory subunit B', gamma
  • Renal carcinoma antigen NY-REN-29
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform

Background

Phosphatases are involved in the regulation of MAP kinases. Protein phosphatase 2A (PP2A) is a critical component of the pathway responsible for p38 MAPK up-regulation of SERT catalytic activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF2945
Species: Hu
Applications: WB
NBP1-82455
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-05767
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38494
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: IHC, WB
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-24613
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-87233
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP2-93798
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

Publications for PPP2R5C Antibody (NBP1-88961) (0)

There are no publications for PPP2R5C Antibody (NBP1-88961).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5C Antibody (NBP1-88961) (0)

There are no reviews for PPP2R5C Antibody (NBP1-88961). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R5C Antibody (NBP1-88961) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R5C Products

Diseases for PPP2R5C Antibody (NBP1-88961)

Discover more about diseases related to PPP2R5C Antibody (NBP1-88961).
 

Pathways for PPP2R5C Antibody (NBP1-88961)

View related products by pathway.

PTMs for PPP2R5C Antibody (NBP1-88961)

Learn more about PTMs related to PPP2R5C Antibody (NBP1-88961).
 

Research Areas for PPP2R5C Antibody (NBP1-88961)

Find related products by research area.

Blogs on PPP2R5C

There are no specific blogs for PPP2R5C, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R5C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5C