PPP2R5E Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PPP2R5E Antibody [NBP1-89464] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: PPP2R5E Antibody [NBP1-89464] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP2R5E Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R5E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPP2R5E Protein (NBP1-89464PEP)
Publications
Read Publication using NBP1-89464.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23204520)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP2R5E Antibody

  • epsilon isoform of regulatory subunit B56, protein phosphatase 2A
  • PP2A B subunit isoform B56-epsilon
  • PP2A B subunit isoform B'-epsilon
  • PP2A B subunit isoform PR61-epsilon
  • PP2A B subunit isoform R5-epsilon
  • PP2A, B subunit, B' epsilon
  • PP2A, B subunit, B56 epsilon
  • PP2A, B subunit, PR61 epsilon
  • PP2A, B subunit, R5 epsilon
  • protein phosphatase 2, regulatory subunit B (B56), epsilon isoform
  • protein phosphatase 2, regulatory subunit B', epsilon isoform
  • serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-32394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
H00029127-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-1704
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-46134
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-47559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-89326
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15581
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89464
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PPP2R5E Antibody (NBP1-89464)(1)

Reviews for PPP2R5E Antibody (NBP1-89464) (0)

There are no reviews for PPP2R5E Antibody (NBP1-89464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PPP2R5E Antibody (NBP1-89464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R5E Products

Bioinformatics Tool for PPP2R5E Antibody (NBP1-89464)

Discover related pathways, diseases and genes to PPP2R5E Antibody (NBP1-89464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R5E Antibody (NBP1-89464)

Discover more about diseases related to PPP2R5E Antibody (NBP1-89464).
 

Pathways for PPP2R5E Antibody (NBP1-89464)

View related products by pathway.

PTMs for PPP2R5E Antibody (NBP1-89464)

Learn more about PTMs related to PPP2R5E Antibody (NBP1-89464).

Blogs on PPP2R5E

There are no specific blogs for PPP2R5E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R5E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5E