PPP2R5E Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PPP2R5E Antibody [NBP1-89464] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPP2R5E Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R5E
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PPP2R5E Protein (NBP1-89464PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23204520)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPP2R5E Antibody - BSA Free

• epsilon isoform of regulatory subunit B56, protein phosphatase 2A
• PP2A B subunit isoform B56-epsilon
• PP2A B subunit isoform B'-epsilon
• PP2A B subunit isoform PR61-epsilon
• PP2A B subunit isoform R5-epsilon
• PP2A, B subunit, B' epsilon
• PP2A, B subunit, B56 epsilon
• PP2A, B subunit, PR61 epsilon
• PP2A, B subunit, R5 epsilon
• PPP2R5E
• protein phosphatase 2, regulatory subunit B (B56), epsilon isoform
• protein phosphatase 2, regulatory subunit B', epsilon isoform
• serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon
• serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an epsilon isoform of the regulatory subunit B56 subfamily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PPP2R5E Antibody (NBP1-89464)(1)

Publication using NBP1-89464

• DeGrande ST, Little SC, Nixon DJ et al. Molecular Mechanisms Underlying Cardiac Protein Phosphatase 2A Regulation in Heart. J Biol Chem 2013-01-11 [PMID: 23204520]

Bioinformatics

• Gene Symbol: PPP2R5E