GALNT2 Antibody

Images

 
Western Blot: GALNT2 Antibody [NBP1-83394] - Analysis in human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: GALNT2 Antibody [NBP1-83394] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GALNT2 Antibody [NBP1-83394] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GALNT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GALNT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GALNT2 Protein (NBP1-83394PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GALNT2 Antibody

  • GalNAc-T2
  • GalNAc-T2EC 2.4.1.41
  • GALNT2
  • Polypeptide GalNac Transferase 2
  • polypeptide N-acetylgalactosaminyltransferase 2
  • pp-GaNTase 2
  • Protein-UDP acetylgalactosaminyltransferase 2
  • UDP-GalNAc transferase 2
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 2 (GalNAc-T2)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-46205
Species: Hu
Applications: WB, IHC
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
AF7140
Species: Hu
Applications: WB, IHC
NBL1-12547
Species: Hu
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NB400-139
Species: Hu, Ha
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GALNT2 Antibody (NBP1-83394) (0)

There are no publications for GALNT2 Antibody (NBP1-83394).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT2 Antibody (NBP1-83394) (0)

There are no reviews for GALNT2 Antibody (NBP1-83394). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GALNT2 Antibody (NBP1-83394) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GALNT2 Products

Bioinformatics Tool for GALNT2 Antibody (NBP1-83394)

Discover related pathways, diseases and genes to GALNT2 Antibody (NBP1-83394). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALNT2 Antibody (NBP1-83394)

Discover more about diseases related to GALNT2 Antibody (NBP1-83394).
 

Pathways for GALNT2 Antibody (NBP1-83394)

View related products by pathway.

PTMs for GALNT2 Antibody (NBP1-83394)

Learn more about PTMs related to GALNT2 Antibody (NBP1-83394).

Blogs on GALNT2

There are no specific blogs for GALNT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GALNT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT2
Entrez