PPP2R5E Antibody - BSA Free

Western Blot: PPP2R5E Antibody [NBP1-79638] - ACHN Cell Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PPP2R5E Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human PPP2R5EThe immunogen for this antibody is PPP2R5E. Peptide sequence QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R5E
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PPP2R5E Antibody - BSA Free

• epsilon isoform of regulatory subunit B56, protein phosphatase 2A
• PP2A B subunit isoform B56-epsilon
• PP2A B subunit isoform B'-epsilon
• PP2A B subunit isoform PR61-epsilon
• PP2A B subunit isoform R5-epsilon
• PP2A, B subunit, B' epsilon
• PP2A, B subunit, B56 epsilon
• PP2A, B subunit, PR61 epsilon
• PP2A, B subunit, R5 epsilon
• PPP2R5E
• protein phosphatase 2, regulatory subunit B (B56), epsilon isoform
• protein phosphatase 2, regulatory subunit B', epsilon isoform
• serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon
• serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an epsilon isoform of the regulatory subunit B56 subfamily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PPP2R5E Antibody (NBP1-79638)(2)

Publications using NBP1-79638

• Lear TB, Lockwood KC, Larsen MB et al. Kelch-like protein 42 is a pro-fibrotic ubiquitin E3 ligase involved in in systemic sclerosis J. Biol. Chem. 2020-02-17 [PMID: 32071084] (WB, Human)
• Lear T Ubiquitin E3 Ligases in Lung Disease Thesis 2020-01-01 (Human)

Bioinformatics

• Gene Symbol: PPP2R5E
• Uniprot:
  • NP_006237(Human)