PPP2R5E Antibody


Western Blot: PPP2R5E Antibody [NBP1-79638] - ACHN Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PPP2R5E Antibody Summary

Synthetic peptide directed towards the N terminal of human PPP2R5EThe immunogen for this antibody is PPP2R5E. Peptide sequence QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against PPP2R5E and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
PPP2R5E Lysate (NBP2-66207)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPP2R5E Antibody

  • epsilon isoform of regulatory subunit B56, protein phosphatase 2A
  • PP2A B subunit isoform B56-epsilon
  • PP2A B subunit isoform B'-epsilon
  • PP2A B subunit isoform PR61-epsilon
  • PP2A B subunit isoform R5-epsilon
  • PP2A, B subunit, B' epsilon
  • PP2A, B subunit, B56 epsilon
  • PP2A, B subunit, PR61 epsilon
  • PP2A, B subunit, R5 epsilon
  • protein phosphatase 2, regulatory subunit B (B56), epsilon isoform
  • protein phosphatase 2, regulatory subunit B', epsilon isoform
  • serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for PPP2R5E Antibody (NBP1-79638) (0)

There are no publications for PPP2R5E Antibody (NBP1-79638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5E Antibody (NBP1-79638) (0)

There are no reviews for PPP2R5E Antibody (NBP1-79638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R5E Antibody (NBP1-79638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional PPP2R5E Products

Bioinformatics Tool for PPP2R5E Antibody (NBP1-79638)

Discover related pathways, diseases and genes to PPP2R5E Antibody (NBP1-79638). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R5E Antibody (NBP1-79638)

Discover more about diseases related to PPP2R5E Antibody (NBP1-79638).

Pathways for PPP2R5E Antibody (NBP1-79638)

View related products by pathway.

PTMs for PPP2R5E Antibody (NBP1-79638)

Learn more about PTMs related to PPP2R5E Antibody (NBP1-79638).

Research Areas for PPP2R5E Antibody (NBP1-79638)

Find related products by research area.

Blogs on PPP2R5E

There are no specific blogs for PPP2R5E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPP2R5E Antibody and receive a gift card or discount.


Gene Symbol PPP2R5E