POU6F2 Antibody - BSA Free

Western Blot: POU6F2 Antibody [NBP2-82314] - WB Suggested Anti-POU6F2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

POU6F2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit POU6F2 Antibody - BSA Free (NBP2-82314) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU6F2. Peptide sequence: AATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU6F2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 73 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for POU6F2 Antibody - BSA Free

• POU class 6 homeobox 2
• Retina-derived POU domain factor 1
• retina-derived POU-domain factor-1
• RPF1
• RPF-1
• RPF-1class 6, transcription factor 2
• Wilms tumor suppressor locus
• WT5
• WTSL

Background

POU6F2, also known as POU domain, class 6, transcription factor 2, is a transcription factor that belongs to the POU protein family. POU6F2 may be implicated in the differentiation of ganglion cells and amacrine cells. Current research on POU6F2 is being performed in relation to several diseases and disorders including Wilms' tumor, retinitis, twinning and neuronitis. Plexin C1 has also been shown to have interactions with SEMA7A in the axon guidance pathway. POU6F2 has also been shown to interact with POU6F1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POU6F2