BXDC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BXDC1 Antibody [NBP1-90031] - Staining of human cell line U-251 MG shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: BXDC1 Antibody [NBP1-90031] - Staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BXDC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BXDC1 Protein (NBP1-90031PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BXDC1 Antibody

  • bA397G5.4
  • brix domain containing 1
  • Brix domain-containing protein 1
  • BXDC1
  • FLJ21087
  • homolog of Rpf2
  • ribosomal processing factor 2 homolog
  • Ribosome biogenesis protein RPF2 homolog
  • ribosome production factor 2 homolog (S. cerevisiae)
  • ribosome production factor 2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80813
Species: Hu
Applications: IHC, IHC-P
NBP1-89915
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03348
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-31801
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55073
Species: Hu
Applications: WB, ICC/IF
NLS1878
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46214
Species: Hu
Applications: WB, IHC

Publications for BXDC1 Antibody (NBP1-90031) (0)

There are no publications for BXDC1 Antibody (NBP1-90031).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BXDC1 Antibody (NBP1-90031) (0)

There are no reviews for BXDC1 Antibody (NBP1-90031). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BXDC1 Antibody (NBP1-90031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BXDC1 Products

Bioinformatics Tool for BXDC1 Antibody (NBP1-90031)

Discover related pathways, diseases and genes to BXDC1 Antibody (NBP1-90031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BXDC1 Antibody (NBP1-90031)

Discover more about diseases related to BXDC1 Antibody (NBP1-90031).
 

Pathways for BXDC1 Antibody (NBP1-90031)

View related products by pathway.

PTMs for BXDC1 Antibody (NBP1-90031)

Learn more about PTMs related to BXDC1 Antibody (NBP1-90031).

Blogs on BXDC1

There are no specific blogs for BXDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BXDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPF2