BXDC1 Antibody

Immunocytochemistry/Immunofluorescence: BXDC1 Antibody [NBP1-90031] - Staining of human cell line U-251 MG shows positivity in nucleus and nucleoli.

Immunohistochemistry-Paraffin: BXDC1 Antibody [NBP1-90031] - Staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

BXDC1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKK
• Predicted Species: Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BXDC1 Protein (NBP1-90031PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BXDC1 Antibody

• bA397G5.4
• brix domain containing 1
• Brix domain-containing protein 1
• BXDC1
• FLJ21087
• homolog of Rpf2
• ribosomal processing factor 2 homolog
• Ribosome biogenesis protein RPF2 homolog
• ribosome production factor 2 homolog (S. cerevisiae)
• ribosome production factor 2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPF2